UDP glucose dehydrogenase Antibody

Images

 
Orthogonal Strategies: Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906] - Analysis in human cell lines A-549 and HEK293 using anti-UGDH antibody. Corresponding UGDH RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: UDP glucose dehydrogenase Antibody [NBP1-90906] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Western Blot: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human liver shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining in human liver and skeletal muscle tissues using anti-UGDH antibody. Corresponding UGDH RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human colon, kidney, liver and prostate using Anti-UGDH antibody NBP1-90906 (A) shows similar ...read more
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human colon.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human kidney.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human prostate.
Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: UDP glucose dehydrogenase Antibody [NBP1-90906] - Staining of human cerebral cortex, liver, prostate and rectum using Anti-UDP glucose dehydrogenase antibody ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UDP glucose dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UDP glucose dehydrogenase Protein (NBP1-90906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UDP glucose dehydrogenase Antibody

  • EC 1.1.1.22
  • GDH
  • UDPGDHUDP-glucose dehydrogenase
  • UDP-Glc dehydrogenase
  • UDP-GlcDH
  • UDP-glucose 6-dehydrogenase
  • UGD
  • uridine diphospho-glucose dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86036
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85871
Species: Hu
Applications: IHC, IHC-P, WB

Publications for UDP glucose dehydrogenase Antibody (NBP1-90906) (0)

There are no publications for UDP glucose dehydrogenase Antibody (NBP1-90906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UDP glucose dehydrogenase Antibody (NBP1-90906) (0)

There are no reviews for UDP glucose dehydrogenase Antibody (NBP1-90906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UDP glucose dehydrogenase Antibody (NBP1-90906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UDP glucose dehydrogenase Products

Bioinformatics Tool for UDP glucose dehydrogenase Antibody (NBP1-90906)

Discover related pathways, diseases and genes to UDP glucose dehydrogenase Antibody (NBP1-90906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UDP glucose dehydrogenase Antibody (NBP1-90906)

Discover more about diseases related to UDP glucose dehydrogenase Antibody (NBP1-90906).
 

Pathways for UDP glucose dehydrogenase Antibody (NBP1-90906)

View related products by pathway.

PTMs for UDP glucose dehydrogenase Antibody (NBP1-90906)

Learn more about PTMs related to UDP glucose dehydrogenase Antibody (NBP1-90906).
 

Research Areas for UDP glucose dehydrogenase Antibody (NBP1-90906)

Find related products by research area.

Blogs on UDP glucose dehydrogenase

There are no specific blogs for UDP glucose dehydrogenase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UDP glucose dehydrogenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGDH