Glucose 1-dehydrogenase Antibody - BSA Free

Western Blot: Glucose 1-dehydrogenase Antibody [NBP1-91942] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: Glucose 1-dehydrogenase Antibody [NBP1-91942] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Western Blot: Glucose 1-dehydrogenase Antibody [NBP1-91942] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Staining of human endometrium shows moderate cytoplasmic membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glucose 1-dehydrogenase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: H6PD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glucose 1-dehydrogenase Protein (NBP1-91942PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22093360)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glucose 1-dehydrogenase Antibody - BSA Free

• 6-phosphogluconolactonase
• DKFZp686A01246
• EC 1.1.1.49
• EC 2.7.4.3
• EC 3.1.1.31
• G6PD, H form
• G6PDH
• GDH/6PGL endoplasmic bifunctional protein
• GDHglucose 1- dehydrogenase
• glucose dehydrogenase
• glucose dehyrogenase
• glucose-6-phosphate dehydrogenase, salivary
• hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
• MGC87643

Background

There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glucose 1-dehydrogenase Antibody (NBP1-91942)(2)

Publications using NBP1-91942

• Cossu V, Bonanomi M, Bauckneht M et al. Two high-rate pentose-phosphate pathways in cancer cells Scientific reports 2020-12-17 [PMID: 33335166] (WB, Human)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: H6PD