Peroxiredoxin 1 Antibody

Images

 
Orthogonal Strategies: Western Blot: Peroxiredoxin 1 Antibody [NBP1-82558] - Analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PRDX1 antibody. Corresponding PRDX1 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Peroxiredoxin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC, WB reported in scientific literature (PMID: 25011585). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control Peptide
Peroxiredoxin 1 Recombinant Protein Antigen (NBP1-82558PEP)
Publications
Read Publications using
NBP1-82558 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25011585).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peroxiredoxin 1 Antibody

  • EC 1.11.1
  • EC 1.11.1.15
  • Natural killer cell-enhancing factor A
  • natural killer-enhancing factor A
  • NKEFA
  • NKEF-A
  • PAG
  • PAGAMSP23
  • PAGB
  • Peroxiredoxin 1
  • peroxiredoxin-1
  • PRDX1
  • proliferation-associated gene A
  • Proliferation-associated gene protein
  • PRX1
  • PRXI
  • TDPX2
  • Thioredoxin peroxidase 2
  • Thioredoxin-dependent peroxide reductase 2

Background

Peroxiredoxin 1 encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-56414
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00051450-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-19777
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06067
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-82558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Peroxiredoxin 1 Antibody (NBP1-82558)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: IF/IHC, IHC, WB.


Filter By Application
IF/IHC
(1)
IHC
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-82558 Applications Species
Liu H, Ke S, Xie M et al. The regulation of expression and splicing of transcription factors are related to the muscle damage caused by radiation in tree shrews Biochemical and biophysical research communications 2023-05-22 [PMID: 37247592]
Aouida M, Aljogol D, Ali R, Ramotar D A simple protocol to isolate a single human cell PRDX1 knockout generated by CRISPR-Cas9 system STAR protocols 2022-03-18 [PMID: 35284843]
Zhu J, Zheng X, Lu D et al. Clinical Relevance and Tumor Growth Suppression of Mitochondrial ROS Regulators along NADH:Ubiquinone Oxidoreductase Subunit B3 in Thyroid Cancer Oxidative medicine and cellular longevity 2022-01-17 [PMID: 35087620] (WB) WB
Minati MA, Libert M, Dahou H et al. N-Acetylcysteine Reduces the Pro-Oxidant and Inflammatory Responses during Pancreatitis and Pancreas Tumorigenesis Antioxidants (Basel) 2021-07-11 [PMID: 34356340] (IHC) IHC
Dahou H, Minati MA, Jacquemin P, Assi M. Genetic Inactivation of Peroxiredoxin-I Impairs the Growth of Human Pancreatic Cancer Cells Antioxidants (Basel) 2021-04-08 [PMID: 33917763]
O'Leary PC, Terrile M, Bajor M et al. Peroxiredoxin-1 protects estrogen receptor alpha from oxidative stress-induced suppression and is a protein biomarker of favorable prognosis in breast cancer. Breast Cancer Res 2014-07-10 [PMID: 25011585] (WB, IF/IHC, Human) WB, IF/IHC Human
Kamper P, Ludvigsen M, Bendix K et al. Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma. Blood 2011-06-01 [PMID: 21505194]
Dammeyer P, Arner ES., et al. Human Protein Atlas of redox systems - What can be learnt? Biochim Biophys Acta 2010-07-18 [PMID: 20647035]

Reviews for Peroxiredoxin 1 Antibody (NBP1-82558) (0)

There are no reviews for Peroxiredoxin 1 Antibody (NBP1-82558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peroxiredoxin 1 Antibody (NBP1-82558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peroxiredoxin 1 Products

Bioinformatics Tool for Peroxiredoxin 1 Antibody (NBP1-82558)

Discover related pathways, diseases and genes to Peroxiredoxin 1 Antibody (NBP1-82558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 1 Antibody (NBP1-82558)

Discover more about diseases related to Peroxiredoxin 1 Antibody (NBP1-82558).
 

Pathways for Peroxiredoxin 1 Antibody (NBP1-82558)

View related products by pathway.

PTMs for Peroxiredoxin 1 Antibody (NBP1-82558)

Learn more about PTMs related to Peroxiredoxin 1 Antibody (NBP1-82558).
 

Research Areas for Peroxiredoxin 1 Antibody (NBP1-82558)

Find related products by research area.

Blogs on Peroxiredoxin 1

There are no specific blogs for Peroxiredoxin 1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX1