Peroxiredoxin 1 Antibody

Images

 
Orthogonal Strategies: Western Blot: Peroxiredoxin 1 Antibody [NBP1-82558] - Analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PRDX1 antibody. Corresponding PRDX1 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Peroxiredoxin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Specificity
Specificity of human Peroxiredoxin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
IHC, WB reported in scientific literature (PMID: 25011585). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control
Peroxiredoxin 1 Knockout 293T Cell Lysate
Control Peptide
Peroxiredoxin 1 Recombinant Protein Antigen (NBP1-82558PEP)
Publications
Read Publications using
NBP1-82558 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25011585).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peroxiredoxin 1 Antibody

  • EC 1.11.1
  • EC 1.11.1.15
  • Natural killer cell-enhancing factor A
  • natural killer-enhancing factor A
  • NKEFA
  • NKEF-A
  • PAG
  • PAGAMSP23
  • PAGB
  • Peroxiredoxin 1
  • peroxiredoxin-1
  • PRDX1
  • proliferation-associated gene A
  • Proliferation-associated gene protein
  • PRX1
  • PRXI
  • TDPX2
  • Thioredoxin peroxidase 2
  • Thioredoxin-dependent peroxide reductase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
H00009588-M01
Species: Hu, Bv
Applications: WB, DB, ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
MAB5285
Species: Hu
Applications: WB, Simple Western
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56414
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
H00051450-D01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-67043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-06067
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-82558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Peroxiredoxin 1 Antibody (NBP1-82558)(3)

Reviews for Peroxiredoxin 1 Antibody (NBP1-82558) (0)

There are no reviews for Peroxiredoxin 1 Antibody (NBP1-82558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peroxiredoxin 1 Antibody (NBP1-82558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Peroxiredoxin 1 Products

Bioinformatics Tool for Peroxiredoxin 1 Antibody (NBP1-82558)

Discover related pathways, diseases and genes to Peroxiredoxin 1 Antibody (NBP1-82558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 1 Antibody (NBP1-82558)

Discover more about diseases related to Peroxiredoxin 1 Antibody (NBP1-82558).
 

Pathways for Peroxiredoxin 1 Antibody (NBP1-82558)

View related products by pathway.

PTMs for Peroxiredoxin 1 Antibody (NBP1-82558)

Learn more about PTMs related to Peroxiredoxin 1 Antibody (NBP1-82558).
 

Research Areas for Peroxiredoxin 1 Antibody (NBP1-82558)

Find related products by research area.

Blogs on Peroxiredoxin 1

There are no specific blogs for Peroxiredoxin 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX1