TAX1BP3 Antibody (4A10)

Images

 
Sandwich ELISA: TAX1BP3 Antibody (4A10) [H00030851-M01] - Detection limit for recombinant GST tagged TAX1BP3 is approximately 0.1 ng/mL as a capture antibody.
Simple Western: TAX1BP3 Antibody (4A10) [H00030851-M01] - This antibody (1:25 dilution) was used to probe THP-1 macrophage lysate (concentrations shown) by Simple Western. Simple Western image submitted by a verified ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ELISA, S-ELISA
Clone
4A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAX1BP3 Antibody (4A10) Summary

Immunogen
TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Localization
Cytoplasm. Nucleus.
Specificity
TAX1BP3 - Tax1 (human T-cell leukemia virus type I) binding protein 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAX1BP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Simple Western
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This TAX1BP3 Antibody (4A10) is validated for Simple Western from a verified customer review.
Reviewed Applications
Read 1 Review rated 3
using
H00030851-M01 in the following applications:

Publications
Read Publication using H00030851-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAX1BP3 Antibody (4A10)

  • 1G5
  • caM kinase-like vesicle-associated protein
  • CaM kinase-like vesicle-associated
  • MGC8407
  • VACAMKL
  • vesicle-associated calmodulin-binding protein

Background

May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
NBP2-02269
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-76626
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-45966
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-12902
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-90029
Species: Hu
Applications: WB, IHC, IHC-P
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TAX1BP3 Antibody (H00030851-M01)(1)

Review for TAX1BP3 Antibody (H00030851-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00030851-M01:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western TAX1BP3 H00030851-M01
Enlarge
3
reviewed by:
Anonymous
Simple Western Human 12/05/2019
View

Summary

ApplicationSimple Western
Sample TestedTHP-1 macrophage lysate
SpeciesHuman
Lot08155-4A10

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAX1BP3 Antibody (H00030851-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAX1BP3 Products

Bioinformatics Tool for TAX1BP3 Antibody (H00030851-M01)

Discover related pathways, diseases and genes to TAX1BP3 Antibody (H00030851-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAX1BP3 Antibody (H00030851-M01)

Discover more about diseases related to TAX1BP3 Antibody (H00030851-M01).
 

Pathways for TAX1BP3 Antibody (H00030851-M01)

View related products by pathway.

PTMs for TAX1BP3 Antibody (H00030851-M01)

Learn more about PTMs related to TAX1BP3 Antibody (H00030851-M01).
 

Research Areas for TAX1BP3 Antibody (H00030851-M01)

Find related products by research area.

Blogs on TAX1BP3

There are no specific blogs for TAX1BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
12/05/2019
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol TAX1BP3
Entrez
Uniprot