AGA Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

AGA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGA Protein (NBP1-88866PEP)
Publications
Read Publication using
NBP1-88866 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGA Antibody

  • AGU
  • aspartylglucosaminidase
  • aspartylglucosylamine deaspartylase
  • ASRG
  • EC 3.5.1
  • EC 3.5.1.26
  • GA
  • glycosylasparaginase
  • N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
  • N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP1-84581
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-35006
Species: Hu
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: IHC, IHC-P

Publications for AGA Antibody (NBP1-88866)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-88866 Applications Species
Kjellman M AN IN VITRO MODEL FOR LYSOSOMAL STORAGE DISEASES USING ASPARTYLGLUCOSAMINURIA PATIENT CELLS Thesis Jan 1 2020 (WB, Human) WB Human

Reviews for AGA Antibody (NBP1-88866) (0)

There are no reviews for AGA Antibody (NBP1-88866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AGA Antibody (NBP1-88866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AGA Products

Bioinformatics Tool for AGA Antibody (NBP1-88866)

Discover related pathways, diseases and genes to AGA Antibody (NBP1-88866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGA Antibody (NBP1-88866)

Discover more about diseases related to AGA Antibody (NBP1-88866).
 

Pathways for AGA Antibody (NBP1-88866)

View related products by pathway.

PTMs for AGA Antibody (NBP1-88866)

Learn more about PTMs related to AGA Antibody (NBP1-88866).

Blogs on AGA

There are no specific blogs for AGA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGA