GDF-9 Antibody (GDF9/4261) [Janelia Fluor® 525] Summary
| Immunogen |
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383) |
| Localization |
Cytoplasmic (secreted) |
| Specificity |
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity. |
| Isotype |
IgG1 |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GDF9 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A or G purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for GDF-9 Antibody (GDF9/4261) [Janelia Fluor® 525]
Background
GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Publications for GDF-9 Antibody (NBP3-08362JF525) (0)
There are no publications for GDF-9 Antibody (NBP3-08362JF525).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GDF-9 Antibody (NBP3-08362JF525) (0)
There are no reviews for GDF-9 Antibody (NBP3-08362JF525).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GDF-9 Antibody (NBP3-08362JF525) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GDF-9 Products
Research Areas for GDF-9 Antibody (NBP3-08362JF525)
Find related products by research area.
|
Blogs on GDF-9