We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GDF-9 Antibody (GDF9/4261) [Alexa Fluor™ Plus 647]

Images

 
There are currently no images for GDF-9 Antibody (NBP3-08362AFP647).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
GDF9/4261
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor Plus 647

Order Details

GDF-9 Antibody (GDF9/4261) [Alexa Fluor™ Plus 647] Summary

Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383)
Localization
Cytoplasmic (secreted)
Specificity
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
GDF9
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes



This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GDF-9 Antibody (GDF9/4261) [Alexa Fluor™ Plus 647]

  • GDF9
  • GDF-9
  • growth differentiation factor 9
  • growth/differentiation factor 9

Background

GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5096-BM
Species: Hu
Applications: BA
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
255-SC
Species: Hu
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
507-BP
Species: Hu
Applications: BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP2-36489
Species: Hu
Applications: IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
MAB505
Species: Hu, Mu
Applications: WB
AF811
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-38770
Species: Hu
Applications: WB
7754-BH/CF
Species: Hu
Applications: BA
DFN00
Species: Hu
Applications: ELISA
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
291-G1
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA

Publications for GDF-9 Antibody (NBP3-08362AFP647) (0)

There are no publications for GDF-9 Antibody (NBP3-08362AFP647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-9 Antibody (NBP3-08362AFP647) (0)

There are no reviews for GDF-9 Antibody (NBP3-08362AFP647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-9 Antibody (NBP3-08362AFP647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDF-9 Products

Research Areas for GDF-9 Antibody (NBP3-08362AFP647)

Find related products by research area.

Blogs on GDF-9

There are no specific blogs for GDF-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-9 Antibody (GDF9/4261) [Alexa Fluor™ Plus 647] and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF9