We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 700]

Images

 
There are currently no images for GDF-9 Antibody (NBP3-08362AF700).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
GDF9/4261
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 700

Order Details

GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 700] Summary

Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383)
Localization
Cytoplasmic (secreted)
Specificity
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
GDF9
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 700]

  • GDF9
  • GDF-9
  • growth differentiation factor 9
  • growth/differentiation factor 9

Background

GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5096-BM
Species: Hu
Applications: BA
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
255-SC
Species: Hu
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
507-BP
Species: Hu
Applications: BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP2-36489
Species: Hu
Applications: IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
MAB505
Species: Hu, Mu
Applications: WB
NBP2-37624
Species: Hu, Pm, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38770
Species: Hu
Applications: WB
7754-BH/CF
Species: Hu
Applications: BA
DFN00
Species: Hu
Applications: ELISA
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
291-G1
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA

Publications for GDF-9 Antibody (NBP3-08362AF700) (0)

There are no publications for GDF-9 Antibody (NBP3-08362AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-9 Antibody (NBP3-08362AF700) (0)

There are no reviews for GDF-9 Antibody (NBP3-08362AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-9 Antibody (NBP3-08362AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDF-9 Products

Research Areas for GDF-9 Antibody (NBP3-08362AF700)

Find related products by research area.

Blogs on GDF-9

There are no specific blogs for GDF-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF9