GATA-6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GATA-6 Antibody [NBP2-55937] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-GATA6 (NBP2-55937) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GATA-6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GATA-6 Antibody - BSA Free (NBP2-55937) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GATA-6 Recombinant Protein Antigen (NBP2-55937PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GATA-6 Antibody - BSA Free

• GATA binding protein 6
• GATA6
• GATA-6
• GATA-binding factor 6
• GATA-binding protein 6
• transcription factor GATA-6

Background

The Gata6 gene is a transcriptional activator that is crucial to modulating terminal differentiation and/or proliferation by regulating SEMA3C and PLXNA2. The Gata6 gene is most prominent during vertebrate development in early and later embryogenesis. Two isoforms exist: isoform 1 is 595 amino acids long at 60 kDa and isoform 2 exists at 449 amino acids in length and 45 kDA. The Gata6 gene focuses on endo- and mesodermally derived cells, thus participating significantly in gut, lung, and heart development and mutations of the Gata6 gene are linked to multiple congenital defects. The Gata6 gene has also been associated with polycystic ovary syndrome, hernias, teratoma, pulmonary fibrosis, germ cell tumor, gastric cancer, Crohn's disease, colorectal cancer, colon cancer, and carcinoma. It is known to interact with KLF13, MED1, HHEX, KLF2, and SP1 as it functions in pathways such as lymphocyte signaling, heart development, hemostasis, and thrombin signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATA6