QRSL Antibody

Images

 
Western Blot: QRSL Antibody [NBP1-87991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: QRSL Antibody [NBP1-87991] - Staining of human bone marrow shows strong cytoplasmic positivity in megakarocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QRSL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDGIPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QRSL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
QRSL Protein (NBP1-87991PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QRSL Antibody

  • DKFZP564C1278
  • EC 6.3.5
  • EC 6.3.5.-
  • FLJ10989
  • FLJ12189
  • FLJ13447
  • GatA
  • glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
  • Glutaminyl-tRNA synthase-like protein 1
  • glutamyl-tRNA(Gln) amidotransferase subunit A homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-56530
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for QRSL Antibody (NBP1-87991) (0)

There are no publications for QRSL Antibody (NBP1-87991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QRSL Antibody (NBP1-87991) (0)

There are no reviews for QRSL Antibody (NBP1-87991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QRSL Antibody (NBP1-87991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QRSL Products

Bioinformatics Tool for QRSL Antibody (NBP1-87991)

Discover related pathways, diseases and genes to QRSL Antibody (NBP1-87991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on QRSL

There are no specific blogs for QRSL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QRSL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QRSL1