Recombinant Human FXR/NR1H4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FXR/NR1H4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 363-472 of Human NR1H4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NR1H4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FXR/NR1H4 Protein

  • BAR
  • bile acid receptor
  • farnesoid X receptor
  • Farnesoid X-activated receptor
  • Farnesol receptor HRR-1
  • FXR
  • FXRBAR
  • HRR-1
  • HRR1MGC163445
  • NR1H4
  • Nuclear receptor subfamily 1 group H member 4
  • nuclear receptor subfamily 1, group H, member 4
  • Retinoid X receptor-interacting protein 14
  • RIP14
  • RIP14RXR-interacting protein 14

Background

NR1H4 - nuclear receptor subfamily 1, group H, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-46522
Species: Hu
Applications: WB, IHC
MAB9120
Species: Hu
Applications: ICC
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-23669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-35013
Species: Hu

Publications for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01) (0)

There are no publications for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01) (0)

There are no reviews for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FXR/NR1H4 Products

Bioinformatics Tool for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01)

Discover related pathways, diseases and genes to FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01)

Discover more about diseases related to FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01).
 

Pathways for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01)

View related products by pathway.

PTMs for FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01)

Learn more about PTMs related to FXR/NR1H4 Partial Recombinant Protein (H00009971-Q01).

Blogs on FXR/NR1H4

There are no specific blogs for FXR/NR1H4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FXR/NR1H4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1H4
Entrez