FXR/NR1H4 Antibody (1B10)

Images

 
Western Blot: FXR/NR1H4 Antibody (1B10) [H00009971-M02] - NR1H4 monoclonal antibody (M02), clone 1B10 Analysis of NR1H4 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: FXR/NR1H4 Antibody (1B10) [H00009971-M02] - Analysis of monoclonal antibody to NR1H4 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: FXR/NR1H4 Antibody (1B10) [H00009971-M02] - Detection limit for recombinant GST tagged NR1H4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FXR/NR1H4 Antibody (1B10) Summary

Immunogen
NR1H4 (NP_005114, 363 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Specificity
nuclear receptor subfamily 1, group H, member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR1H4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publications using H00009971-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FXR/NR1H4 Antibody (1B10)

  • BAR
  • bile acid receptor
  • farnesoid X receptor
  • Farnesoid X-activated receptor
  • Farnesol receptor HRR-1
  • FXR
  • FXRBAR
  • HRR-1
  • HRR1MGC163445
  • NR1H4
  • Nuclear receptor subfamily 1 group H member 4
  • nuclear receptor subfamily 1, group H, member 4
  • Retinoid X receptor-interacting protein 14
  • RIP14
  • RIP14RXR-interacting protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NLS5411
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-23669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
NBP1-37003
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88192
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85016
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
NBP2-66958
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
DF1900
Species: Hu
Applications: ELISA
H00009971-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for FXR/NR1H4 Antibody (H00009971-M02)(2)

Reviews for FXR/NR1H4 Antibody (H00009971-M02) (0)

There are no reviews for FXR/NR1H4 Antibody (H00009971-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FXR/NR1H4 Antibody (H00009971-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXR/NR1H4 Products

Bioinformatics Tool for FXR/NR1H4 Antibody (H00009971-M02)

Discover related pathways, diseases and genes to FXR/NR1H4 Antibody (H00009971-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXR/NR1H4 Antibody (H00009971-M02)

Discover more about diseases related to FXR/NR1H4 Antibody (H00009971-M02).
 

Pathways for FXR/NR1H4 Antibody (H00009971-M02)

View related products by pathway.

PTMs for FXR/NR1H4 Antibody (H00009971-M02)

Learn more about PTMs related to FXR/NR1H4 Antibody (H00009971-M02).

Blogs on FXR/NR1H4

There are no specific blogs for FXR/NR1H4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXR/NR1H4 Antibody (1B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1H4
Entrez
OMIM
Uniprot