FoxP3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FoxP3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FoxP3
  
  

  Source: E.coli

  Amino Acid Sequence: GCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVAS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FOXP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25325It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FoxP3 Recombinant Protein Antigen

• AIID
• AIIDMGC141961
• DIETER
• forkhead box P3
• Forkhead Box Protein P3
• FoxP3
• FOXP3delta7
• immune dysregulation, polyendocrinopathy, enteropathy, X-linked
• Immunodeficiency, Polyendocrinopathy, Enteropathy, X-Linked
• IPEX
• JM2
• MGC141961
• MGC141963
• PIDX
• PIDXMGC141963
• SCURFIN
• XPID
• XPIDpolyendocrinopathy, enteropathy, X-linked

Background

Forkhead box P3 (FoxP3), aka Scurfin and JM2, is a protein involving in immune system responses and functioning as a transcriptional regulator crucial in the development and inhibitory of regulatory T-Cells (Treg). FoxP3 is a master regulator of the Treg lineage, who requires Ahr and STAT-5 and other additional transcription factors to retains its complete function and differentiation. Scurfin remains steady and constitutively expressed in two conditions: a high level in CD25 + CD4 positive regulatory T cells and a low level in CD4 positive/CD25 negative cells. JM2 is absent in CD4 negative/CD8 positive T cells. FoxP3 defects are related to various cancers and autoimmune diseases, and X-linked syndrome (IPEX), while overexpression may also cause severe immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

FAQs for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP). (Showing 1 - 2 of 2 FAQ).

1. Does FoxP3 antibodies comes in lyophilized form?
   • FoxP3 antibodies, aka JM2 IPEX, and Scurfin antibodies, have the following products in lyophilized form: NBP1-18319, AF3240.
2. What the theoretical molecular weight for FoxP3 antibodies?
   • The TMW of FoxP3 antibodies is approximately 47 - 52 kDa.

Bioinformatics

• Gene Symbol: FOXP3