FoxP3 Recombinant Protein Antigen

Images

 
There are currently no images for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FoxP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FoxP3

Source: E.coli

Amino Acid Sequence: GCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25325It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FoxP3 Recombinant Protein Antigen

  • AIID
  • AIIDMGC141961
  • DIETER
  • forkhead box P3
  • Forkhead Box Protein P3
  • FoxP3
  • FOXP3delta7
  • immune dysregulation, polyendocrinopathy, enteropathy, X-linked
  • Immunodeficiency, Polyendocrinopathy, Enteropathy, X-Linked
  • IPEX
  • JM2
  • MGC141961
  • MGC141963
  • PIDX
  • PIDXMGC141963
  • SCURFIN
  • XPID
  • XPIDpolyendocrinopathy, enteropathy, X-linked

Background

Forkhead box P3 (FoxP3), aka Scurfin and JM2, is a protein involving in immune system responses and functioning as a transcriptional regulator crucial in the development and inhibitory of regulatory T-Cells (Treg). FoxP3 is a master regulator of the Treg lineage, who requires Ahr and STAT-5 and other additional transcription factors to retains its complete function and differentiation. Scurfin remains steady and constitutively expressed in two conditions: a high level in CD25 + CD4 positive regulatory T cells and a low level in CD4 positive/CD25 negative cells. JM2 is absent in CD4 negative/CD8 positive T cells. FoxP3 defects are related to various cancers and autoimmune diseases, and X-linked syndrome (IPEX), while overexpression may also cause severe immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DR2A00
Species: Hu
Applications: ELISA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DY417
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
DY421
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
MAB689
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DDX0700P-100
Species: Ca, Hu
Applications: B/N, Flow, IP
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB

Publications for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP) (0)

There are no publications for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP) (0)

There are no reviews for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP). (Showing 1 - 2 of 2 FAQ).

  1. Does FoxP3 antibodies comes in lyophilized form?
    • FoxP3 antibodies, aka JM2 IPEX, and Scurfin antibodies, have the following products in lyophilized form: NBP1-18319, AF3240.
  2. What the theoretical molecular weight for FoxP3 antibodies?
    • The TMW of FoxP3 antibodies is approximately 47 - 52 kDa.

Additional FoxP3 Products

Research Areas for FoxP3 Recombinant Protein Antigen (NBP3-25325PEP)

Find related products by research area.

Blogs on FoxP3.

Meeting Report: 2nd International Antibody Validation Meeting
Bio-Techne brands Novus Biologicals® and R&D Systems® were proud to support the 2nd International Antibody Validation Meeting held at Bath University, on the 15-16 September, 2016. Almost 100 participants from around the world, including funde...  Read full blog post.

FOXP3
Is has been established that the regulatory transcription factor FOXP3 (a member of the forkhead/winged-helix family of transcription factors) is imperative to immune system homeostasis through CD4+CD25+ regulatory T cell function.  Distinctively, ...  Read full blog post.

FOXP3 is a Master Regulator of T Regulatory (Treg) Cells
FOXP3, a member of forkhead/winged-helix family of transcription factors acts as a "master" regulator for the development and suppressive function of regulatory T cells (Tregs). Its constitutive expression is necessary for the suppressive function of ...  Read full blog post.

FOXP3: Master Regulatory Transcriptional Factor
FOXP3, a forkhead family transcription factor specially expressed in regulatory T (Treg) cells, controls the expression of many key immune-regulatory genes. Treg cells are a population of T lymphocytes that have critical roles in the immune system hom...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FoxP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXP3