FGF-21 Antibody - BSA Free

Immunohistochemistry-Paraffin: FGF-21 Antibody [NBP2-32347] - FGF21 Antibody [NBP2-32347] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp. Red blood cells were distinctly stained.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGF-21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FGF-21 Antibody - BSA Free (NBP2-32347) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FGF-21 Protein (NBP2-32347PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FGF-21 Antibody - BSA Free

• FGF21
• FGF-21
• fibroblast growth factor 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF21