FGF-21 Antibody

Images

 
Immunohistochemistry-Paraffin: FGF-21 Antibody [NBP2-32347] - FGF21 Antibody [NBP2-32347] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp. Red blood cells were ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGF-21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGF-21 Protein (NBP2-32347PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGF-21 Antibody

  • FGF21
  • FGF-21
  • fibroblast growth factor 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-35013
Species: Hu
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
2629-FG/CF
Species: Mu
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2619
Species: Mu
Applications: WB
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for FGF-21 Antibody (NBP2-32347) (0)

There are no publications for FGF-21 Antibody (NBP2-32347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-21 Antibody (NBP2-32347) (0)

There are no reviews for FGF-21 Antibody (NBP2-32347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-21 Antibody (NBP2-32347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-21 Products

Bioinformatics Tool for FGF-21 Antibody (NBP2-32347)

Discover related pathways, diseases and genes to FGF-21 Antibody (NBP2-32347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-21 Antibody (NBP2-32347)

Discover more about diseases related to FGF-21 Antibody (NBP2-32347).
 

Pathways for FGF-21 Antibody (NBP2-32347)

View related products by pathway.

PTMs for FGF-21 Antibody (NBP2-32347)

Learn more about PTMs related to FGF-21 Antibody (NBP2-32347).
 

Research Areas for FGF-21 Antibody (NBP2-32347)

Find related products by research area.

Blogs on FGF-21

There are no specific blogs for FGF-21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF21
Entrez