FGF-21 Antibody


Immunohistochemistry-Paraffin: FGF-21 Antibody [NBP2-32347] - FGF21 Antibody [NBP2-32347] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp. Red blood cells were ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FGF-21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS
Specificity of human FGF-21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGF-21 Protein (NBP2-32347PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FGF-21 Antibody

  • FGF21
  • FGF-21
  • fibroblast growth factor 21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Mu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P

Publications for FGF-21 Antibody (NBP2-32347) (0)

There are no publications for FGF-21 Antibody (NBP2-32347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-21 Antibody (NBP2-32347) (0)

There are no reviews for FGF-21 Antibody (NBP2-32347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-21 Antibody (NBP2-32347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF-21 Products

Bioinformatics Tool for FGF-21 Antibody (NBP2-32347)

Discover related pathways, diseases and genes to FGF-21 Antibody (NBP2-32347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-21 Antibody (NBP2-32347)

Discover more about diseases related to FGF-21 Antibody (NBP2-32347).

Pathways for FGF-21 Antibody (NBP2-32347)

View related products by pathway.

PTMs for FGF-21 Antibody (NBP2-32347)

Learn more about PTMs related to FGF-21 Antibody (NBP2-32347).

Research Areas for FGF-21 Antibody (NBP2-32347)

Find related products by research area.

Blogs on FGF-21

There are no specific blogs for FGF-21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF-21 Antibody and receive a gift card or discount.


Gene Symbol FGF21