FGF-21 Antibody - BSA Free

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FGF-21 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FGF21(fibroblast growth factor 21) The peptide sequence was selected from the N terminal of FGF21 (NP_061986). Peptide sequence DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Simple Western 1:100
  • Western Blot 0.2-1 ug/ml
• Application Notes: In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: antibody dilution of 1:100. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FGF-21 Antibody - BSA Free

• FGF21
• FGF-21
• fibroblast growth factor 21

Background

FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FGF-21 Antibody (NBP1-59291)(3)

Publications using NBP1-59291

• Kang SG, Lee SE, Choi MJ et al. Th2 Cytokines Increase the Expression of Fibroblast Growth Factor 21 in the Liver Cells 2021-05-24 [PMID: 34073755] (Western Blot, Human)
• Makela Johanna, Tselykh Timofey V, Maiorana Francesca et al. Fibroblast growth factor-21 enhances mitochondrial functions and increases the activity of PGC-1a in human dopaminergic neurons via Sirtuin-1. Springerplus 2014-01-01 [PMID: 25932355] (WB, Human)
• Crooks DR, Natarajan TG, Jeong SY et al. Elevated FGF21 secretion, PGC-1alpha and ketogenic enzyme expression are hallmarks of iron-sulfur cluster depletion in human skeletal muscle. Hum Mol Genet. 2013-09-07 [PMID: 23943793] (WB, Human)

Bioinformatics

• Gene Symbol: FGF21
• Entrez:
  • 26291(Human)
• Uniprot:
  • Q9NSA1()