ERP44 Antibody

Images

 
Western Blot: ERP44 Antibody [NBP1-89617] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ERP44 Antibody [NBP1-89617] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERP44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERP44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERP44 Protein (NBP1-89617PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERP44 Antibody

  • endoplasmic reticulum protein 44
  • endoplasmic reticulum resident protein 44 kDa
  • ER protein 44
  • ERp44
  • KIAA0573endoplasmic reticulum resident protein 44
  • PDIA10
  • protein disulfide isomerase family A, member 10
  • thioredoxin domain containing 4 (endoplasmic reticulum)
  • Thioredoxin domain-containing protein 4
  • TXNDC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-2466
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-83093
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-89617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ERP44 Antibody (NBP1-89617) (0)

There are no publications for ERP44 Antibody (NBP1-89617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERP44 Antibody (NBP1-89617) (0)

There are no reviews for ERP44 Antibody (NBP1-89617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERP44 Antibody (NBP1-89617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERP44 Products

Bioinformatics Tool for ERP44 Antibody (NBP1-89617)

Discover related pathways, diseases and genes to ERP44 Antibody (NBP1-89617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERP44 Antibody (NBP1-89617)

Discover more about diseases related to ERP44 Antibody (NBP1-89617).
 

Pathways for ERP44 Antibody (NBP1-89617)

View related products by pathway.

PTMs for ERP44 Antibody (NBP1-89617)

Learn more about PTMs related to ERP44 Antibody (NBP1-89617).

Blogs on ERP44

There are no specific blogs for ERP44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERP44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERP44