TXNDC15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TXNDC15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNDC15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TXNDC15 Protein (NBP1-89394PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TXNDC15 Antibody

  • C5orf14
  • chromosome 5 open reading frame 14
  • disulfide isomerase
  • FLJ22625
  • thioredoxin domain containing 15,2310047H23Rik
  • thioredoxin domain-containing protein 15
  • UNQ335

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
AF1543
Species: Hu
Applications: WB, IHC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-49154
Species: Hu
Applications: IHC
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for TXNDC15 Antibody (NBP1-89394) (0)

There are no publications for TXNDC15 Antibody (NBP1-89394).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNDC15 Antibody (NBP1-89394) (0)

There are no reviews for TXNDC15 Antibody (NBP1-89394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TXNDC15 Antibody (NBP1-89394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNDC15 Products

Bioinformatics Tool for TXNDC15 Antibody (NBP1-89394)

Discover related pathways, diseases and genes to TXNDC15 Antibody (NBP1-89394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TXNDC15

There are no specific blogs for TXNDC15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNDC15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNDC15