gamma Sarcoglycan Antibody

Images

 
Western Blot: gamma Sarcoglycan Antibody [NBP1-90299] - Analysis in control (vector only transfected HEK293T lysate) and SGCG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-90299] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining in human heart muscle and prostate tissues using anti-SGCG antibody. Corresponding SGCG RNA-seq data are ...read more
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

gamma Sarcoglycan Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQD
Specificity
Specificity of human gamma Sarcoglycan antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Gamma Sarcoglycan antibody validated for IHC-Fr from a verified customer review.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
gamma Sarcoglycan Protein (NBP1-90299PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-90299 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gamma Sarcoglycan Antibody

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-sarcoglycan
  • gamma-SG
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • SCARMD2
  • SCG3LGMD2C
  • TYPE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-37456
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47829
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for gamma Sarcoglycan Antibody (NBP1-90299) (0)

There are no publications for gamma Sarcoglycan Antibody (NBP1-90299).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for gamma Sarcoglycan Antibody (NBP1-90299) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-90299:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen gamma Sarcoglycan NBP1-90299
Enlarge
5
reviewed by:
Margherita verardo
IHC-Fr Human 10/08/2019
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedSkeletal muscle tissue
SpeciesHuman
LotA57738

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for gamma Sarcoglycan Antibody (NBP1-90299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional gamma Sarcoglycan Products

Bioinformatics Tool for gamma Sarcoglycan Antibody (NBP1-90299)

Discover related pathways, diseases and genes to gamma Sarcoglycan Antibody (NBP1-90299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Sarcoglycan Antibody (NBP1-90299)

Discover more about diseases related to gamma Sarcoglycan Antibody (NBP1-90299).
 

Pathways for gamma Sarcoglycan Antibody (NBP1-90299)

View related products by pathway.

Blogs on gamma Sarcoglycan

There are no specific blogs for gamma Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Margherita verardo
10/08/2019
Application: IHC-Fr
Species: Human

Bioinformatics

Gene Symbol SGCG
Entrez
Uniprot