AHCYL1 Antibody


Western Blot: AHCYL1 Antibody [NBP1-83093] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: AHCYL1 Antibody [NBP1-83093] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AHCYL1 Antibody [NBP1-83093] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.
Genetic Strategies: Western Blot: AHCYL1 Antibody [NBP1-83093] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: ...read more
Immunohistochemistry-Paraffin: AHCYL1 Antibody [NBP1-83093] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in ducts.
Immunohistochemistry-Paraffin: AHCYL1 Antibody [NBP1-83093] - Staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AHCYL1 Antibody [NBP1-83093] - Staining of human endometrium shows weak membranous positivity in glandular cells.
Immunohistochemistry: AHCYL1 Antibody [NBP1-83093] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Validated by:

Genetic Strategies


Order Details

AHCYL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTK
Specificity of human, mouse, rat AHCYL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AHCYL1 Protein (NBP1-83093PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AHCYL1 Antibody

  • adenosylhomocysteinase-like 1
  • AdoHcyase 2
  • DCAL
  • DC-expressed AHCY-like molecule
  • dendritic cell expressed AHCY-like protein
  • inositol 14,5-trisphosphate receptor-binding protein
  • PRO0233
  • putative adenosylhomocysteinase 2
  • S-adenosyl homocysteine hydrolase homolog
  • S-adenosylhomocysteine hydrolase-like 1
  • S-adenosylhomocysteine hydrolase-like protein 1
  • S-adenosyl-L-homocysteine hydrolase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB (-), IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for AHCYL1 Antibody (NBP1-83093) (0)

There are no publications for AHCYL1 Antibody (NBP1-83093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AHCYL1 Antibody (NBP1-83093) (0)

There are no reviews for AHCYL1 Antibody (NBP1-83093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AHCYL1 Antibody (NBP1-83093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional AHCYL1 Products

Bioinformatics Tool for AHCYL1 Antibody (NBP1-83093)

Discover related pathways, diseases and genes to AHCYL1 Antibody (NBP1-83093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AHCYL1 Antibody (NBP1-83093)

Discover more about diseases related to AHCYL1 Antibody (NBP1-83093).

Pathways for AHCYL1 Antibody (NBP1-83093)

View related products by pathway.

PTMs for AHCYL1 Antibody (NBP1-83093)

Learn more about PTMs related to AHCYL1 Antibody (NBP1-83093).

Blogs on AHCYL1

There are no specific blogs for AHCYL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AHCYL1 Antibody and receive a gift card or discount.


Gene Symbol AHCYL1