PADI1 Antibody


Immunocytochemistry/ Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining in human esophagus and colon tissues using anti-PADI1 antibody. Corresponding PADI1 RNA-seq data are presented for the more

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PADI1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN.
Specificity of human PADI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PADI1 Protein (NBP2-37761PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PADI1 Antibody

  • EC
  • HPAD10
  • hPAD-colony 10
  • PAD1
  • PDI
  • PDI1Protein-arginine deiminase type I
  • peptidyl arginine deiminase, type I
  • Peptidylarginine deiminase I
  • protein-arginine deiminase type-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PADI1 Antibody (NBP2-37761) (0)

There are no publications for PADI1 Antibody (NBP2-37761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PADI1 Antibody (NBP2-37761) (0)

There are no reviews for PADI1 Antibody (NBP2-37761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PADI1 Antibody (NBP2-37761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PADI1 Antibody (NBP2-37761)

Discover related pathways, diseases and genes to PADI1 Antibody (NBP2-37761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PADI1 Antibody (NBP2-37761)

Discover more about diseases related to PADI1 Antibody (NBP2-37761).

Pathways for PADI1 Antibody (NBP2-37761)

View related products by pathway.

Blogs on PADI1

There are no specific blogs for PADI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PADI1 Antibody and receive a gift card or discount.


Gene Symbol PADI1