SLC6A4/5-HTTLPR/Serotonin transporter Antibody

Images

 
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody.Lane 1: SLC6A4 transfected lysate(70.30 KDa).Lane ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC6A4/5-HTTLPR/Serotonin transporter Antibody Summary

Immunogen
SLC6A4 (AAH69484.1, 1 a.a. - 630 a.a.) full-length human protein. METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
Specificity
SLC6A4 - solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006532-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-60120
Species: Hu
Applications: WB, TCS
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS3921
Species: Hu, Mk, Pm
Applications: IHC-P
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86922
Species: Hu
Applications: IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-45995
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P) (0)

There are no reviews for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

Discover related pathways, diseases and genes to SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

Discover more about diseases related to SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P).
 

Pathways for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

View related products by pathway.

PTMs for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

Learn more about PTMs related to SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P).
 

Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter

There are no specific blogs for SLC6A4/5-HTTLPR/Serotonin transporter, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A4/5-HTTLPR/Serotonin transporter Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A4
Entrez
Uniprot