SLC6A4/5-HTTLPR/Serotonin transporter Antibody

Images

 
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from ...read more
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC6A4/5-HTTLPR/Serotonin transporter Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
SLC6A4 (AAH69484.1, 1 a.a. - 630 a.a.) full-length human protein. METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
Specificity
SLC6A4 - solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Reviewed Applications
Read 1 Review rated 3
using
H00006532-D01P in the following application:

Publications
Read Publication using H00006532-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Review for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006532-D01P:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry SLC6A4/5-HTTLPR/Serotonin transporter H00006532-D01P
Enlarge
3
reviewed by:
Tamara Haque
Flow Mouse 10/30/2018
View

Summary

ApplicationFlow Cytometry
Sample TestedBone marrow derived cells
SpeciesMouse
LotHB301

Comments

Commentsdilution used: 1:25

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-D01P)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter.

Epigenetics of Depression: How Can Psychological Stress Alter Your DNA?
By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Tamara Haque
10/30/2018
Application: Flow
Species: Mouse

Bioinformatics

Gene Symbol SLC6A4
Entrez
Uniprot