| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 8S10A7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit EEA1 Antibody (8S10A7) (NBP3-16537) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEA1 (Q15075). MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLK |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | EEA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 162 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EEA1 Antibody (NBP3-16537)Find related products by research area.
|
|
Understanding EEA1's Role in Membrane Endosome Fusion EEA1, or Early Endosome Antigen 1 is a Rab5 effector essential for early endocytic membrane fusion. The EEA1 antibody is used in membrane trafficking and chaperone studies, and as an endosome marker. We at Novus Biologicals have a comprehensive antibo... Read full blog post. |
|
EEA1 Antibodies in Endosomal Transport and Signalling Studies EEA1, or Early Endosome Antigen 1, is a phospholipid-binding protein essential for endosomal membrane trafficking and fusion, and is a useful endosomal marker. We at Novus Biologicals have an extensive EEA1 antibody catalog, with antibodies that have ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EEA1 |