HGS Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HGS Antibody [NBP1-83202] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83202] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83202] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83202] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83202] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Analysis in control (vector only transfected HEK293T lysate) and HGS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HGS Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HGS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HGS Protein (NBP1-83202PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 21189249)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HGS Antibody - BSA Free

• FLJ39878
• hepatocyte growth factor-regulated tyrosine kinase substrate
• Hrs
• HRSFLJ11421
• human growth factor-regulated tyrosine kinase substrate
• Protein pp110
• Vps27
• ZFYVE8

Background

HGS is involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early end

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HGS Antibody (NBP1-83202)(1)

Publication using NBP1-83202

• Brockmeyer C, Paster W, Pepper D et al. T cell receptor (TCR)-induced tyrosine phosphorylation dynamics identifies THEMIS as a new TCR signalosome component. J Biol Chem 2011-03-04 [PMID: 21189249]

Bioinformatics

• Gene Symbol: HGS