RAB7B Antibody (3B3) - Azide and BSA Free

Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B monoclonal antibody (M01), clone 3B3. Analysis of RAB7B expression in human kidney.

Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B expression in HeLa ( Cat # L013V1 ).

Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B monoclonal antibody (M01), clone 3B3. Analysis of RAB7B expression in A-431.

Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - Analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: RAB7B Antibody (3B3) [H00338382-M01] - Analysis of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B MaxPab rabbit polyclonal antibody.

ELISA: RAB7B Antibody (3B3) [H00338382-M01] - Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 3B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB7B Antibody (3B3) - Azide and BSA Free Summary

• Immunogen: RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
• Marker: Late Endosome Marker
• Specificity: RAB7B - RAB7B, member RAS oncogene family
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB7B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB7B Antibody (3B3) - Azide and BSA Free

• MGC16212
• MGC9726
• RAB7
• RAB7B, member RAS oncogene family
• Ras-related protein Rab-7
• ras-related protein Rab-7b

Background

Members of the RAB family of RAS related GTP binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. RAB7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB7B Antibody (H00338382-M01)(7)

Publications using H00338382-M01

• K Vestre, I Persiconi, MB Distefano, N Mensali, NA Guadagno, M Bretou, S Wälchli, C Arnold-Sch, O Bakke, M Dalod, AM Lennon-Dum, C Progida Rab7b regulates dendritic cell migration by linking lysosomes to the actomyosin cytoskeleton Journal of Cell Science, 2021-09-24;0(0):. 2021-09-24 [PMID: 34494097]
• Margiotta A, Progida C, Bakke O, Bucci C. Rab7a regulates cell migration through Rac1 and vimentin. Biochim Biophys Acta 2017-02-01 [PMID: 27888097]
• Borg M, Bakke O, Progida C. A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration. J Cell Sci. 2014-09-12 [PMID: 25217632]
• Zlatic SA, Tornieri K, L'hernault SW, Faundez V. Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells. Mol Biol Cell. 2011-03-16 [PMID: 21411634]
• Higashi S, Iseki E, Minegishi M et al. GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. J Neurochem. 2010-07-28 [PMID: 20670374]
• Higashi S, Moore DJ, Yamamoto R et al. Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease. J Neuropathol Exp Neurol 68(9):994-1005. 2009-09-01 [PMID: 19680143]
• Zhu GD, Salazar G, Zlatic SA et al. SPE-39 Family Proteins Interact with the HOPS Complex and Function in Lysosomal Delivery. Mol Biol Cell. 2009-02-01 [PMID: 19109425]

Reviews for RAB7B Antibody (H00338382-M01) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Xi Zhang IF Mouse 05/09/2014

Summary

• Application: Immunofluorescence
• Sample Tested: mouse primary cell
• Species: Mouse

reviewed by: Xi Zhang IF Mouse 04/30/2014

Summary

• Application: Immunofluorescence
• Species: Mouse

Bioinformatics

• Gene Symbol: RAB7B
• Entrez:
  • 338382(Human)
• Uniprot:
  • NP_796377(Human)