RAB7B Antibody (3B3)

Images

 
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B monoclonal antibody (M01), clone 3B3. Analysis of RAB7B expression in human kidney.
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B expression in HeLa ( Cat # L013V1 ).
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B monoclonal antibody (M01), clone 3B3. Analysis of RAB7B expression in A-431.
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - Analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: ...read more
Immunoprecipitation: RAB7B Antibody (3B3) [H00338382-M01] - Analysis of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B MaxPab rabbit polyclonal ...read more
ELISA: RAB7B Antibody (3B3) [H00338382-M01] - Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
3B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB7B Antibody (3B3) Summary

Immunogen
RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Marker
Late Endosome Marker
Specificity
RAB7B - RAB7B, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB7B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA.
Reviewed Applications
Read 2 Reviews rated 4
using
H00338382-M01 in the following applications:

Publications
Read Publications using H00338382-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB7B Antibody (3B3)

  • MGC16212
  • MGC9726
  • RAB7
  • RAB7B, member RAS oncogene family
  • Ras-related protein Rab-7
  • ras-related protein Rab-7b

Background

Members of the RAB family of RAS related GTP binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. RAB7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB7B Antibody (H00338382-M01)(7)


Showing Publications 1 - 7 of 7.
Publications using H00338382-M01 Applications Species
K Vestre, I Persiconi, MB Distefano, N Mensali, NA Guadagno, M Bretou, S Wälchli, C Arnold-Sch, O Bakke, M Dalod, AM Lennon-Dum, C Progida Rab7b regulates dendritic cell migration by linking lysosomes to the actomyosin cytoskeleton Journal of Cell Science, 2021-09-24;0(0):. 2021-09-24 [PMID: 34494097]
Margiotta A, Progida C, Bakke O, Bucci C. Rab7a regulates cell migration through Rac1 and vimentin. Biochim Biophys Acta 2017-02-01 [PMID: 27888097]
Borg M, Bakke O, Progida C. A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration. J Cell Sci. 2014-09-12 [PMID: 25217632]
Zlatic SA, Tornieri K, L'hernault SW, Faundez V. Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells. Mol Biol Cell. 2011-03-16 [PMID: 21411634]
Higashi S, Iseki E, Minegishi M et al. GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. J Neurochem. 2010-07-28 [PMID: 20670374]
Higashi S, Moore DJ, Yamamoto R et al. Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease. J Neuropathol Exp Neurol 68(9):994-1005. 2009-09-01 [PMID: 19680143]
Zhu GD, Salazar G, Zlatic SA et al. SPE-39 Family Proteins Interact with the HOPS Complex and Function in Lysosomal Delivery. Mol Biol Cell. 2009-02-01 [PMID: 19109425]

Reviews for RAB7B Antibody (H00338382-M01) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using H00338382-M01:
Filter by Applications
IF
(2)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence RAB7B H00338382-M01
Enlarge
4
reviewed by:
Xi Zhang
IF Mouse 05/09/2014
View

Summary

ApplicationImmunofluorescence
Sample Testedmouse primary cell
SpeciesMouse
  4
reviewed by:
Xi Zhang
IF Mouse 04/30/2014
View

Summary

ApplicationImmunofluorescence
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB7B Antibody (H00338382-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB7B Products

Research Areas for RAB7B Antibody (H00338382-M01)

Find related products by research area.

Blogs on RAB7B

There are no specific blogs for RAB7B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Xi Zhang
05/09/2014
Application: IF
Species: Mouse

 
Xi Zhang
04/30/2014
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol RAB7B
Entrez
Uniprot