HARS Antibody

Images

 
Western Blot: HARS Antibody [NBP1-89490] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: HARS Antibody [NBP1-89490] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human kidney shows positivity in cells in tubules.
Genetic Strategies: Western Blot: HARS Antibody [NBP1-89490] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HARS antibody. Remaining relative ...read more
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human skin shows positivity in epidermal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebellum shows positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

HARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD
Specificity
Specificity of human HARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HARS Protein (NBP1-89490PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HARS Antibody

  • cytoplasmic
  • EC 6.1.1.21
  • FLJ20491
  • histidine-tRNA ligase
  • histidyl-tRNA synthetase
  • histidyl-tRNA synthetase, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB200-112
Species: Hu, Mu, Rt, Ha, Pm, Pm
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
AF5708
Species: Hu
Applications: WB, ICC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36568
Species: Hu, Mu
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86170
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89427
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56375
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HARS Antibody (NBP1-89490) (0)

There are no publications for HARS Antibody (NBP1-89490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HARS Antibody (NBP1-89490) (0)

There are no reviews for HARS Antibody (NBP1-89490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HARS Antibody (NBP1-89490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HARS