E-Cadherin Recombinant Protein Antigen

Images

 
There are currently no images for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

E-Cadherin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH1.

Source: E.coli

Amino Acid Sequence: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-34475. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for E-Cadherin Recombinant Protein Antigen

  • Arc-1
  • CAD1
  • cadherin 1, E-cadherin (epithelial)
  • cadherin 1, type 1, E-cadherin (epithelial)
  • Cadherin-1
  • calcium-dependent adhesion protein, epithelial
  • CAM 120/80
  • CD324 antigen
  • CD324
  • CDH1
  • CDHE
  • cell-CAM 120/80
  • Cell-CAM120/80
  • ECAD
  • ECadherin
  • E-Cadherin
  • Epithelial cadherin
  • LCAM
  • L-CAM
  • UVOE-Cadherin
  • Uvomorulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC

Publications for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP) (0)

There are no publications for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP) (0)

There are no reviews for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP)

Discover related pathways, diseases and genes to E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP)

Discover more about diseases related to E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP).
 

Pathways for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP)

View related products by pathway.

PTMs for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP)

Learn more about PTMs related to E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP).
 

Research Areas for E-Cadherin Recombinant Protein Antigen (NBP2-34475PEP)

Find related products by research area.

Blogs on E-Cadherin.

Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer
Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed...  Read full blog post.

SOX2 - a stem cell transcription factor
The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al...  Read full blog post.

Beta-catenin - I am versatile!
Beta-catenin is a cytosolic, 88 kDa intracellular protein associated with cell surface cadherin glycoproteins. It is a member of the larger calcium-dependent catenin family that includes alpha-catenin, beta-catenin, and gamma-catenin (also known as pl...  Read full blog post.

Vimentin: Regulating EMT and Cancer
Vimentin, a member of the intermediate filament (IF) family, is a protein responsible for maintaining cellular integrity and reducing damage caused by stress. The vimentin protein is ubiquitously expressed in normal mesenchymal cells, and recent resea...  Read full blog post.

Carbonic Anhydrase IX Roles in Tumor Growth, Survival and Invasion
Carbonic anhydrase IX (CAIX) is a membrane-associated carbonic anhydrase, strongly induced by hypoxia. CA IX is overexpressed by several cancer cells from many tumor types, and is a component of the pH regulatory system invoked by these cells to comba...  Read full blog post.

E-Cadherin as a Cancer Biomarker
E-cadherin is a calcium-regulated adhesion molecule expressed in most normal epithelial tissues. E-cadherin is also associated with gland formation, stratification, and epithelial polarization, while loss of E-cadherin can cause dedifferentiation and...  Read full blog post.

E-Cadherin in Cell-Cell Adhesion and Cancer Diagnostics
E-Cadherin is a member of the cadherin superfamily and is fundamental player in a wide range of cellular processes such as development, morphology, polarity, migration and tissue integrity. Specifically, E-cadherin is an approximately 100 kDa epitheli...  Read full blog post.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our E-Cadherin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH1
Entrez