Immunocytochemistry/ Immunofluorescence: DEPP1 Antibody [NBP2-38367] - Staining of human cell line U-2 OS shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DEPP1 Antibody [NBP2-38367] - Staining of human urinary bladder shows moderate positivity in endothelial cells.
Novus Biologicals Rabbit DEPP1 Antibody - BSA Free (NBP2-38367) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DEPP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C10ORF10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Please note that WB was reported in PMID 28545464 which used a previous lot that is no longer available. The current lot of this antibody is not validated for use in WB. Please contact technical services if you have any questions.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for DEPP1 Antibody - BSA Free
C10orf10
chromosome 10 open reading frame 10
Decidual protein induced by progesterone
DEPP
fasting induced
Fasting-induced gene protein
fasting-induced protein
FIG
protein DEPP
Background
The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the encoded protein leads to phosphorylation and activation of the transcription factor ELK1. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our DEPP1 Antibody - BSA Free and receive a gift card or discount.