Calcium Channel Flower Homolog Antibody

Images

 
Western Blot: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression ...read more
Immunocytochemistry/ Immunofluorescence: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calcium Channel Flower Homolog Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calcium Channel Flower Homolog Recombinant Protein Antigen (NBP1-84307PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcium Channel Flower Homolog Antibody

  • CACFD1
  • calcium channel flower domain containing 1
  • calcium channel flower homolog
  • chromosome 9 open reading frame 7
  • D9S2135
  • FLOWER

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA

Publications for Calcium Channel Flower Homolog Antibody (NBP1-84307) (0)

There are no publications for Calcium Channel Flower Homolog Antibody (NBP1-84307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium Channel Flower Homolog Antibody (NBP1-84307) (0)

There are no reviews for Calcium Channel Flower Homolog Antibody (NBP1-84307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calcium Channel Flower Homolog Antibody (NBP1-84307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Calcium Channel Flower Homolog Products

Bioinformatics Tool for Calcium Channel Flower Homolog Antibody (NBP1-84307)

Discover related pathways, diseases and genes to Calcium Channel Flower Homolog Antibody (NBP1-84307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Calcium Channel Flower Homolog

There are no specific blogs for Calcium Channel Flower Homolog, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcium Channel Flower Homolog Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACFD1