Calcium Channel Flower Homolog Antibody

Western Blot: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413631)

Immunocytochemistry/Immunofluorescence: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Calcium Channel Flower Homolog Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACFD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Calcium Channel Flower Homolog Recombinant Protein Antigen (NBP1-84307PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calcium Channel Flower Homolog Antibody

• CACFD1
• calcium channel flower domain containing 1
• calcium channel flower homolog
• chromosome 9 open reading frame 7
• D9S2135
• FLOWER

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACFD1