Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SULT2A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody - BSA Free
Background
Dehydroepiandrosterone (DHEA) is a major secretory product of the human adrenal cortex during intrauterine development as well as during adulthood. DHEA circulates in the bloodstream as DHEA-sulfate (DHEAS). DHEA has been implicated in a wide range of physiological roles including aging, immunology, learning and memory and obesity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB, IHC
Publications for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402) (0)
There are no publications for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402) (0)
There are no reviews for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytosolic Sulfotransferase 2A1/SULT2A1 Products
Research Areas for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-49402)
Find related products by research area.
|
Blogs on Cytosolic Sulfotransferase 2A1/SULT2A1