PBX1 Antibody (4A2)

Images

 
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA: PBX1 Antibody (4A2) [H00005087-M01] - Detection limit for recombinant GST tagged PBX1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP, ChIP
Clone
4A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PBX1 Antibody (4A2) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PBX1 (NP_002576, 213 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Specificity
PBX1 - pre-B-cell leukemia transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PBX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP)
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 26610607).
Publications
Read Publications using H00005087-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBX1 Antibody (4A2)

  • DKFZp686B09108
  • Homeobox protein PBX1
  • Homeobox protein PRL
  • MGC126627
  • Pre-B cell leukemia transcription factor-1
  • pre-B-cell leukemia homeobox 1
  • pre-B-cell leukemia transcription factor 1
  • PRL

Background

PBX1 binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PBX1 Antibody (H00005087-M01)(12)

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00005087-M01 Applications Species
Satoshi S, Mayuko I, Yuko M et al. Histological and immunohistochemical analysis of epithelial cells in epidermoid cysts in intrapancreatic accessory spleen. J Med Invest. 2023-02-15 [PMID: 37164730]
Yinan L, Ertao Z, Junting C et al. m 6 A-mediated regulation of PBX1-GCH1 axis promotes gastric cancer proliferation and metastasis by elevating tetrahydrobiopterin levels. Cancer Commun (Lond). 2022-03-09 [PMID: 35261206]
Yao-An S, Jin J, Geoffrey S et al. Development of small molecule inhibitors targeting PBX1 transcription signaling as a novel cancer therapeutic strategy. iScience. 2021-11-19 [PMID: 34816098]
Toska E, Castel P, Chhangawala S et al. PI3K Inhibition Activates SGK1 via a Feedback Loop to Promote Chromatin-Based Regulation of ER-Dependent Gene Expression. Cell Rep. 2019-04-02 [PMID: 30943409]
Wang J, Shidfar A, Ivancic D et al. Overexpression of lipid metabolism genes and PBX1 in the contralateral breasts of women with estrogen receptor-negative breast cancer. Int J Cancer 2017-03-21 [PMID: 28263391]
Ramberg H, Grytli HH, Nygard S et al. PBX3 is a putative biomarker of aggressive prostate cancer. Int J Cancer 2016-10-15 [PMID: 27273830]
DellOrso S, Wang AH, Shih HY et al. The Histone Variant MacroH2A1.2 Is Necessary for the Activation of Muscle Enhancers and Recruitment of the Transcription Factor Pbx1. Cell Rep 2016-02-09 [PMID: 26832413]
Nguyen VT, Barozzi I, Faronato M et al. Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion. Nat Commun 2015-01-01 [PMID: 26610607] (IF/IHC) IF/IHC
Magnani L, Ballantyne EB, Zhang X, Lupien M. PBX1 Genomic Pioneer Function Drives ER alpha Signaling Underlying Progression in Breast Cancer. PLoS Genet. 2011-11-17 [PMID: 22125492]
Bjerke GA, Hyman-Walsh C, Wotton D. Cooperative transcriptional activation by klf4, meis2, and pbx1. Mol Cell Biol. 2011-07-11 [PMID: 21746878]
Show All 12 Publications.

Reviews for PBX1 Antibody (H00005087-M01) (0)

There are no reviews for PBX1 Antibody (H00005087-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX1 Antibody (H00005087-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBX1 Antibody (4A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX1
Entrez
OMIM
Uniprot