PBX1 Antibody (4A2)

Images

 
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA: PBX1 Antibody (4A2) [H00005087-M01] - Detection limit for recombinant GST tagged PBX1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PBX1 Antibody (4A2) Summary

Immunogen
PBX1 (NP_002576 213 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Specificity
PBX1 - pre-B-cell leukemia transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PBX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00005087-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBX1 Antibody (4A2)

  • DKFZp686B09108
  • Homeobox protein PBX1
  • Homeobox protein PRL
  • MGC126627
  • Pre-B cell leukemia transcription factor-1
  • pre-B-cell leukemia homeobox 1
  • pre-B-cell leukemia transcription factor 1
  • PRL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC

Publications for PBX1 Antibody (H00005087-M01)(8)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 8 of 8.
Publications using H00005087-M01 Applications Species
Wang J, Shidfar A, Ivancic D et al. Overexpression of lipid metabolism genes and PBX1 in the contralateral breasts of women with estrogen receptor-negative breast cancer. Int J Cancer 2017 Mar 21 [PMID: 28263391]
Ramberg H, Grytli HH, Nygard S et al. PBX3 is a putative biomarker of aggressive prostate cancer. Int J Cancer 2016 Oct 15 [PMID: 27273830]
DellOrso S, Wang AH, Shih HY et al. The Histone Variant MacroH2A1.2 Is Necessary for the Activation of Muscle Enhancers and Recruitment of the Transcription Factor Pbx1. Cell Rep 2016 Feb 9 [PMID: 26832413]
Nguyen VT, Barozzi I, Faronato M et al. Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion. Nat Commun 2015 [PMID: 26610607] (IHC) IHC
Magnani L, Ballantyne EB, Zhang X, Lupien M. PBX1 Genomic Pioneer Function Drives ER alpha Signaling Underlying Progression in Breast Cancer. PLoS Genet. 2011 Nov 17 [PMID: 22125492]
Bjerke GA, Hyman-Walsh C, Wotton D. Cooperative transcriptional activation by klf4, meis2, and pbx1. Mol Cell Biol. 2011 Jul 11 [PMID: 21746878]
Horman SR, Velu CS, Chaubey A et al. Gfi1 integrates progenitor versus granulocytic transcriptional programming. Blood. 2009 Apr 3. [PMID: 19346496]
Cheung CL, Chan BY, Chan V et al. Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation. Hum Mol Genet. 2009 Feb 15 [PMID: 19064610]

Reviews for PBX1 Antibody (H00005087-M01) (0)

There are no reviews for PBX1 Antibody (H00005087-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX1 Antibody (H00005087-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PBX1 Antibody (H00005087-M01)

Discover related pathways, diseases and genes to PBX1 Antibody (H00005087-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX1 Antibody (H00005087-M01)

Discover more about diseases related to PBX1 Antibody (H00005087-M01).
 

Pathways for PBX1 Antibody (H00005087-M01)

View related products by pathway.

PTMs for PBX1 Antibody (H00005087-M01)

Learn more about PTMs related to PBX1 Antibody (H00005087-M01).

Blogs on PBX1

There are no specific blogs for PBX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBX1 Antibody (4A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX1
Entrez
OMIM
Uniprot