Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody [NBP2-32604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma ...read more
Immunocytochemistry/ Immunofluorescence: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody [NBP2-32604] - Immunofluorescent staining of human cell line RT4 shows localization to cytosol.
Immunohistochemistry: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody [NBP2-32604] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT2A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytosolic Sulfotransferase 2A1/SULT2A1 Protein (NBP2-32604PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody

  • alcohol/hydroxysteroid sulfotransferase
  • Cytosolic Sulfotransferase 2A1
  • Dehydroepiandrosterone sulfotransferase
  • DHEAS
  • DHEA-ST
  • DHEA-STbile salt sulfotransferase
  • EC 2.8.2.14
  • HST
  • hSTa
  • Hydroxysteroid Sulfotransferase
  • ST2
  • ST2A1
  • ST2A3
  • STDbile-salt sulfotranasferase 2A1
  • Sulfotransferase 2A1
  • sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1
  • SULT2A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604) (0)

There are no publications for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604) (0)

There are no reviews for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 2A1/SULT2A1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604)

Discover more about diseases related to Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604).
 

Pathways for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604)

Learn more about PTMs related to Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP2-32604).

Blogs on Cytosolic Sulfotransferase 2A1/SULT2A1

There are no specific blogs for Cytosolic Sulfotransferase 2A1/SULT2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT2A1
Entrez