CNOT6 Antibody


Immunocytochemistry/ Immunofluorescence: CNOT6 Antibody [NBP1-86564] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CNOT6 Antibody [NBP1-86564] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CNOT6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
Specificity of human CNOT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT6 Protein (NBP1-86564PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CNOT6 Antibody

  • carbon catabolite repression 4 protein
  • Carbon catabolite repressor protein 4 homolog
  • CCR4 carbon catabolite repression 4-like
  • CCR4CCR4-NOT transcription complex subunit 6
  • CCR4-NOT transcription complex, subunit 6
  • Cytoplasmic deadenylase
  • EC
  • KIAA1194EC 3.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready, Neut

Publications for CNOT6 Antibody (NBP1-86564) (0)

There are no publications for CNOT6 Antibody (NBP1-86564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT6 Antibody (NBP1-86564) (0)

There are no reviews for CNOT6 Antibody (NBP1-86564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CNOT6 Antibody (NBP1-86564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CNOT6 Products

Array NBP1-86564

Bioinformatics Tool for CNOT6 Antibody (NBP1-86564)

Discover related pathways, diseases and genes to CNOT6 Antibody (NBP1-86564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT6 Antibody (NBP1-86564)

Discover more about diseases related to CNOT6 Antibody (NBP1-86564).

Pathways for CNOT6 Antibody (NBP1-86564)

View related products by pathway.

PTMs for CNOT6 Antibody (NBP1-86564)

Learn more about PTMs related to CNOT6 Antibody (NBP1-86564).

Blogs on CNOT6

There are no specific blogs for CNOT6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNOT6 Antibody and receive a gift card or discount.


Gene Symbol CNOT6