CNOT6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CNOT6 Antibody [NBP1-86564] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CNOT6 Antibody [NBP1-86564] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNOT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT6 Protein (NBP1-86564PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNOT6 Antibody

  • carbon catabolite repression 4 protein
  • Carbon catabolite repressor protein 4 homolog
  • CCR4 carbon catabolite repression 4-like
  • CCR4CCR4-NOT transcription complex subunit 6
  • CCR4-NOT transcription complex, subunit 6
  • Cytoplasmic deadenylase
  • EC 3.1.13.4
  • KIAA1194EC 3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00004185-M01
Species: Hu
Applications: WB, ELISA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-709
Species: Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for CNOT6 Antibody (NBP1-86564) (0)

There are no publications for CNOT6 Antibody (NBP1-86564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT6 Antibody (NBP1-86564) (0)

There are no reviews for CNOT6 Antibody (NBP1-86564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CNOT6 Antibody (NBP1-86564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT6 Products

Bioinformatics Tool for CNOT6 Antibody (NBP1-86564)

Discover related pathways, diseases and genes to CNOT6 Antibody (NBP1-86564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT6 Antibody (NBP1-86564)

Discover more about diseases related to CNOT6 Antibody (NBP1-86564).
 

Pathways for CNOT6 Antibody (NBP1-86564)

View related products by pathway.

PTMs for CNOT6 Antibody (NBP1-86564)

Learn more about PTMs related to CNOT6 Antibody (NBP1-86564).

Blogs on CNOT6

There are no specific blogs for CNOT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT6