CDC25B Antibody - BSA Free

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry: CDC25B Antibody [NBP2-32627] - Staining of human tonsil shows strong cytoplasmic positivity in subset of germinal center cells.

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining in human lymph node and pancreas tissues using anti-CDC25B antibody. Corresponding CDC25B RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDC25B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDC25B Antibody - BSA Free (NBP2-32627) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC25B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CDC25B Protein (NBP2-32627PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDC25B Antibody - BSA Free

• CDC25B
• CDC25HU2
• cell division cycle 25 homolog B (S. cerevisiae)
• cell division cycle 25 homolog B (S. pombe)
• cell division cycle 25B
• Dual specificity phosphatase Cdc25B
• EC 3.1.3.48
• M-phase inducer phosphatase 2

Background

CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC25B