CDC2/CDK1 Antibody

Images

 
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CDC2/CDK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Specificity
Specificity of human, mouse, rat CDC2/CDK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
CDC2/CDK1 Protein (NBP1-85729PEP)
Publications
Read Publications using
NBP1-85729 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23405159)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC2/CDK1 Antibody

  • CDC2
  • CDC28A
  • CDC2MGC111195
  • CDK1
  • cell cycle controller CDC2
  • Cell division control protein 2 homolog
  • Cell division protein kinase 1
  • cyclin-dependent kinase 1
  • DKFZp686L20222
  • EC 2.7.11.22
  • EC 2.7.11.23
  • G1 to S and G2 to M
  • p34 protein kinase
  • P34CDC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDC2/CDK1 Antibody (NBP1-85729)(3)

Reviews for CDC2/CDK1 Antibody (NBP1-85729) (0)

There are no reviews for CDC2/CDK1 Antibody (NBP1-85729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDC2/CDK1 Antibody (NBP1-85729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDC2/CDK1 Antibody (NBP1-85729)

Discover related pathways, diseases and genes to CDC2/CDK1 Antibody (NBP1-85729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2/CDK1 Antibody (NBP1-85729)

Discover more about diseases related to CDC2/CDK1 Antibody (NBP1-85729).
 

Pathways for CDC2/CDK1 Antibody (NBP1-85729)

View related products by pathway.

PTMs for CDC2/CDK1 Antibody (NBP1-85729)

Learn more about PTMs related to CDC2/CDK1 Antibody (NBP1-85729).
 

Research Areas for CDC2/CDK1 Antibody (NBP1-85729)

Find related products by research area.

Blogs on CDC2/CDK1

There are no specific blogs for CDC2/CDK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2/CDK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK1
Entrez