TMED7 Antibody

Images

 
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
Immunohistochemistry: Rabbit Polyclonal TMED7 Antibody [NBP1-90949] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry: Rabbit Polyclonal TMED7 Antibody [NBP1-90949] - Immunohistochemical staining of human kidney shows moderate cytoplasm granular positivity in cells in tubules.
Immunohistochemistry: Rabbit Polyclonal TMED7 Antibody [NBP1-90949] - Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry: Rabbit Polyclonal TMED7 Antibody [NBP1-90949] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMED7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMED7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMED7-TICAM2 Protein (NBP1-90949PEP)
Publications
Read Publication using NBP1-90949.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMED7 Antibody

  • transmembrane emp24 domain-containing protein 7
  • CGI-109
  • p27
  • transmembrane emp24 protein transport domain containing 7

Background

TMED7 is a gene that codes for a protein with two isoforms measuring 224 and 188 amino acids in length, with weights of approximately 25 and 21 kDa respectively. TMED7 plays a role in vesicular protein trafficking as well as the biosynthesis of secreted cargo. Current research is being done on diseases and disorders related to this gene including leukemia and lung cancer. TMED7 has also been shown to have interactions with IL1R1, IL1RAP, IRAK2, IRAK3, and IRF3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMED7 Antibody (NBP1-90949)(1)

Reviews for TMED7 Antibody (NBP1-90949) (0)

There are no reviews for TMED7 Antibody (NBP1-90949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMED7 Antibody (NBP1-90949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMED7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMED7