| Immunogen | This CD45 Antibody was developed against a Recombinant Protein corresponding to amino acids: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTPRC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 147 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-88103 | Applications | Species |
|---|---|---|
| Do T Development and Characterization of a Novel Three-Dimensional Human Tissue-Engineered Lung Model to Study Immune Response to Respiratory Syncytial Virus in Vulnerable Populations Thesis 2023-01-01 (Immunohistochemistry, Human) | Immunohistochemistry | Human |
| Edlund K, Lindskog C, Saito A et al. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. Int J Cancer 2012-11-15 [PMID: 22392539] | ||
| Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360] |
Secondary Antibodies |
Isotype Controls |
|
Read full blog post. |
|
How To Identify B Cell Subsets Using Flow Cytometry By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified... Read full blog post. |
|
You complete me: Natural killer cells need TGF-beta inhibition to effectively combat cancers By Jamshed Arslan Pharm.D. Natural killer (NK) cells are lymphocytes of the innate immune system that were first discovered for their “natural” ability to kill cancer cells. To use NK cells as anti-cancer therapy, t... Read full blog post. |
|
The application of CD31/Pecam-1 (MEC 7.46) in breast cancer research CD31/PECAM-1, or platelet endothelial cell adhesion molecule 1, is a 130-kDa glycoprotein expressed on vascular and hematopoietic cells. Depending on the cell type, CD31/PECAM-1 expression can be largely localized to cell junctions, playing a rol... Read full blog post. |
|
CD45 - Much more than just a housekeeping protein CD45, also known as T200 or the Leukocyte Common Antigen (LCA), is encoded by the Protein Tyrosine Phosphatase Receptor type C (PTPRC) gene. The protein is expressed exclusively on cells of the haematopoietic system, and is one of the most abundant le... Read full blog post. |
|
CD45 Isoforms: Hematopoietic Differentiation, Cancer and Alzheimer's CD45, also known as protein tyrosine phosphatase, receptor type, C (PTPRC), was originally known as common leukocyte antigen and is a signal transducer involved in many physiological processes such as growth and differentiation, cancer transformation,... Read full blog post. |
|
Vimentin Antibodies in Rheumatoid Arthritis & Cataracts Research Vimentin is a 57kDa type III intermediate filament (IF) protein that is the major cytoskeletal component of mesenchymal cells and the first to be expressed during cell differentiation. It plays a significant role in supporting and anchoring the positi... Read full blog post. |
|
Antibodies In The Differential Diagnosis Of Undifferentiated Tumors Immunohistochemical testing using antibody panels has a valuable role in cancer diagnosis. Some tumors, especially more malignant ones, tend to lose the appearance of the tissue of origin. However, knowing the tissue of origin assists the physician in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTPRC |