CD133 Antibody

Images

 
Western Blot: CD133 Antibody [NBP2-59789] - Analysis in human cell line CACO-2 and human cell line PC-3.
Immunohistochemistry-Paraffin: CD133 Antibody [NBP2-59789] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: CD133 Antibody [NBP2-59789] - Staining of human breast shows moderate to strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CD133 Antibody [NBP2-59789] - Staining of human cervix shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CD133 Antibody [NBP2-59789] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: CD133 Antibody [NBP2-59789] - Staining in human cervix, uterine and liver tissues using NBP2-59789 antibody. Corresponding PROM1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD133 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acid sequence: LQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTII
Specificity
Specificity of human CD133 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROM1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD133 Recombinant Protein Antigen (NBP2-59789PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CD133 Antibody

  • AC133 Stargardt disease 4 (autosomal dominant)
  • AC133
  • CD133 retinal 2
  • CD133
  • PROM1
  • prominin (mouse)-like 1
  • Prominin 1
  • PROML1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NB100-65543
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59789
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD133 Antibody (NBP2-59789) (0)

There are no publications for CD133 Antibody (NBP2-59789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD133 Antibody (NBP2-59789) (0)

There are no reviews for CD133 Antibody (NBP2-59789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD133 Antibody (NBP2-59789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CD133 Products

Array NBP2-59789

Bioinformatics Tool for CD133 Antibody (NBP2-59789)

Discover related pathways, diseases and genes to CD133 Antibody (NBP2-59789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD133 Antibody (NBP2-59789)

Discover more about diseases related to CD133 Antibody (NBP2-59789).
 

Pathways for CD133 Antibody (NBP2-59789)

View related products by pathway.

PTMs for CD133 Antibody (NBP2-59789)

Learn more about PTMs related to CD133 Antibody (NBP2-59789).
 

Research Areas for CD133 Antibody (NBP2-59789)

Find related products by research area.

Blogs on CD133.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

ATG9A - early marker autophagosome assembly
ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade...  Read full blog post.

CD133
Also known as PROM1 and AC133, this gene is located on chromosome 4p15 and encodes CD133, a 120kDa pentaspan transmembrane glycoprotein (5-TM) and presents multiple spliced variants. Prominin-1 (CD133) was the first protein identified as "Prominin"; o...  Read full blog post.

CD Antibodies Uncover Markers for Rare Breast Cancer
We at Novus Biologicals have added several new products to our CD antibody database. The CD, or Cluster of Differential proteins are a family of type I transmembrane glycoproteins widely expressed in immune cell populations. These include B cells, thy...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD133 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PROM1