Recombinant Human CD11b Protein

Images

 
SDS-Page: Recombinant Human CD11b Protein [H00003684-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CD11b Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 111 - 220 of Human ITGAM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGAM

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD11b Protein

  • antigen CD11b (p170)
  • CD11 antigen-like family member B
  • CD11b antigen
  • CD11b
  • CD11Bintegrin, alpha M (complement component receptor 3, alpha; also known as CD11b(p170), macrophage antigen alpha polypeptide)
  • Cell surface glycoprotein MAC-1 subunit alpha
  • CR-3 alpha chain
  • CR3AMGC117044
  • Integrin alpha M
  • integrin alpha-M
  • integrin, alpha M (complement component 3 receptor 3 subunit)
  • ITGAM
  • Leukocyte adhesion receptor MO1
  • MAC-1
  • MAC1A
  • macrophage antigen alpha polypeptide
  • MO1A
  • neutrophil adherence receptor alpha-M subunit
  • Neutrophil adherence receptor
  • SLEB6

Background

ITGAM - integrin, alpha M (complement component receptor 3, alpha; also known as CD11b (p170), macrophage antigen alpha polypeptide)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
796-IC
Species: Mu
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003684-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CD11b Partial Recombinant Protein (H00003684-Q01) (0)

There are no publications for CD11b Partial Recombinant Protein (H00003684-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD11b Partial Recombinant Protein (H00003684-Q01) (0)

There are no reviews for CD11b Partial Recombinant Protein (H00003684-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD11b Partial Recombinant Protein (H00003684-Q01). (Showing 1 - 7 of 7 FAQ).

  1. I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
    • I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
  2. What types of cells can this CD11b antibody be used as a marker for?
    • A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
  3. Do you know if this CD11b antibody can be used in CD11b positive cell depletion? 
    • This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
  4. Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
    • I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
  5. We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
    • We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
  6. The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
    • The protocol is referencting the PIER method using Proteinase K as the enzyme.
  7. I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
    • We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.

Additional CD11b Products

Bioinformatics Tool for CD11b Partial Recombinant Protein (H00003684-Q01)

Discover related pathways, diseases and genes to CD11b Partial Recombinant Protein (H00003684-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD11b Partial Recombinant Protein (H00003684-Q01)

Discover more about diseases related to CD11b Partial Recombinant Protein (H00003684-Q01).
 

Pathways for CD11b Partial Recombinant Protein (H00003684-Q01)

View related products by pathway.

PTMs for CD11b Partial Recombinant Protein (H00003684-Q01)

Learn more about PTMs related to CD11b Partial Recombinant Protein (H00003684-Q01).
 

Research Areas for CD11b Partial Recombinant Protein (H00003684-Q01)

Find related products by research area.

Blogs on CD11b.

Topics in CD11b: The innate immune response
Integrins are transmembrane receptors composed of alpha and beta chains, where beta-integrins are mainly expressed in leukocytes. Leukocytes are white blood cells that act in the immune system to defend our body against foreign pathogens.  Integrin...  Read full blog post.

CD11b - More than a microglial marker
The protein CD11b has been implicated in the various adhesion-related interactions of cells such as monocytes, macrophages, natural killer (NK) cells, and granulocytes. It is part of a heterodimer that consists of CD11b and CD18. It also modulates the...  Read full blog post.

CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity
Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a...  Read full blog post.

Adhesion Receptor Molecule CD11b/c is the Point of Entry for many Infectious Diseases
Pathogenic microorganisms utilize a variety of cell surface receptors to gain entry into host cells and to bypass the natural defense mechanisms. One of the most prominent receptors used in this fashion is the leukocyte adhesion receptor CD11b/c. This...  Read full blog post.

CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies
The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a...  Read full blog post.

The CD11b Antibody: A Marker for Microglial Cells
Microglia are the resident macrophages of the central nervous system, and the first line of immune defense. Pioneering antibody research in the 1990's identified the Integrin beta 2 protein (also called ITGB2, complement receptor 3, CR3, CD18, and Mac...  Read full blog post.

CD11b Expression, Leukocyte Adhesion and the Innate Immune System
CD11b is an integrin family member which pairs with CD18 to form the CR3 heterodimer. CD11b is expressed on the surface of many leukocytes including monocytes, neutrophils, natural killer cells, granulocytes and macrophages, as well as on 8% of spleen...  Read full blog post.

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474
ICAM-1/CD54
796-IC-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD11b Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAM
Entrez