CD117/c-kit Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CD117/c-kit Antibody [NBP2-57890] - Staining of human cell line HEK 293 shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD117/c-kit Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Specificity
Specificity of human CD117/c-kit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP)

Reactivity Notes

Mouse 88%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CD117/c-kit Antibody

  • CD117 antigen
  • CD117
  • ckit
  • c-kit
  • EC 2.7.10
  • EC 2.7.10.1
  • KIT
  • PBT
  • piebald trait
  • Proto-oncogene c-Kit
  • proto-oncogene tyrosine-protein kinase Kit
  • SCF R
  • SCFR
  • SCFRmast/stem cell growth factor receptor
  • soluble KIT variant 1
  • Tyrosine-protein kinase Kit
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1042
Species: Mu
Applications: WB, IHC
NBP2-57890
Species: Hu
Applications: ICC/IF

Publications for CD117/c-kit Antibody (NBP2-57890) (0)

There are no publications for CD117/c-kit Antibody (NBP2-57890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD117/c-kit Antibody (NBP2-57890) (0)

There are no reviews for CD117/c-kit Antibody (NBP2-57890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD117/c-kit Antibody (NBP2-57890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD117/c-kit Antibody (NBP2-57890)

Discover related pathways, diseases and genes to CD117/c-kit Antibody (NBP2-57890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD117/c-kit Antibody (NBP2-57890)

Discover more about diseases related to CD117/c-kit Antibody (NBP2-57890).
 

Pathways for CD117/c-kit Antibody (NBP2-57890)

View related products by pathway.

PTMs for CD117/c-kit Antibody (NBP2-57890)

Learn more about PTMs related to CD117/c-kit Antibody (NBP2-57890).
 

Research Areas for CD117/c-kit Antibody (NBP2-57890)

Find related products by research area.

Blogs on CD117/c-kit.

Do you see what I see? I c-Kit
The c-Kit (CD117) proto-oncogene is a 145 kD receptor tyrosine kinase family closely related to platelet-derived growth factor receptor (PDGFR). It is a transmembrane receptor and the cellular homolog of the HZ4-feline sarcoma virus transforming gene...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD117/c-kit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIT
Entrez