CCR7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCR7 Antibody [NBP2-57375] - Staining of human cell line A549 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCR7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
Specificity
Specificity of human CCR7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCR7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCR7 Recombinant Protein Antigen (NBP2-57375PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCR7 Antibody

  • BLR2C-C chemokine receptor type 7
  • C-C CKR-7
  • CC-CKR-7
  • CCR7
  • CCR-7
  • CD197 antigen
  • CD197
  • CDw197CC chemokine receptor 7
  • chemokine (C-C motif) receptor 7
  • CMKBR7chemokine (C-C) receptor 7
  • EBI1EBV-induced G protein-coupled receptor 1
  • EBV-induced G-protein coupled receptor 1
  • Epstein-Barr virus induced gene 1
  • Epstein-Barr virus induced G-protein coupled receptor
  • Epstein-Barr virus-induced G-protein coupled receptor 1
  • EVI1
  • lymphocyte-specific G protein-coupled peptide receptor
  • MIP-3 beta receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

366-6C/CF
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF728
Species: Hu
Applications: WB, AdBlk
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1437
Species: Mu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
6507-IL/CF
Species: Hu

Publications for CCR7 Antibody (NBP2-57375) (0)

There are no publications for CCR7 Antibody (NBP2-57375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCR7 Antibody (NBP2-57375) (0)

There are no reviews for CCR7 Antibody (NBP2-57375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCR7 Antibody (NBP2-57375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CCR7 Antibody (NBP2-57375)

Discover related pathways, diseases and genes to CCR7 Antibody (NBP2-57375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCR7 Antibody (NBP2-57375)

Discover more about diseases related to CCR7 Antibody (NBP2-57375).
 

Pathways for CCR7 Antibody (NBP2-57375)

View related products by pathway.

PTMs for CCR7 Antibody (NBP2-57375)

Learn more about PTMs related to CCR7 Antibody (NBP2-57375).
 

Research Areas for CCR7 Antibody (NBP2-57375)

Find related products by research area.

Blogs on CCR7

There are no specific blogs for CCR7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCR7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCR7