Cathepsin G Antibody (2S2U10)

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] - Western blot analysis of various lysates, using Cathepsin G Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Western Blot: Cathepsin G Antibody (2S2U10) [NBP3-33320] - Western blot analysis of lysates from THP-1 cells, using Cathepsin G Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 2S2U10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cathepsin G Antibody (2S2U10) Summary

• Description: Novus Biologicals Rabbit Cathepsin G Antibody (2S2U10) (NBP3-33320) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 156-255 of human Cathepsin G (NP_001902.1).
  
  Sequence:
  TDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTSG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Cathepsin G Antibody (2S2U10)

• cathepsin G
• CathepsinG
• CGCATG
• EC 3.4.21
• EC 3.4.21.20
• MGC23078

Background

Cathepsin G is encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSG