BMP-7 Antibody


Western Blot: BMP-7 Antibody [NBP1-69126] - Human Fetal Intestine, Antibody Dilution: 0.1 ug/ml.
Immunohistochemistry: BMP-7 Antibody [NBP1-69126] - Human kidney (Proteinase K) Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 5000Color/Signal Descriptions: more
Western Blot: BMP-7 Antibody [NBP1-69126] - Titration: 0.2-1 ug/ml, Positive Control: Rat Lung.
Immunohistochemistry-Paraffin: BMP-7 Antibody [NBP1-69126] - Human Kidney tissue, 5 ug/ml.
Immunohistochemistry-Paraffin: BMP-7 Antibody [NBP1-69126] - Human Skin.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

BMP-7 Antibody Summary

Synthetic peptides corresponding to Bmp7 (bone morphogenetic protein 7) The peptide sequence was selected from the N terminal of Bmp7. Peptide sequence MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Bmp7 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
16 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP-7 Antibody

  • BMP7
  • BMP-7
  • bone morphogenetic protein 7
  • Eptotermin alfa
  • OP-1
  • OP-1OP1
  • Osteogenic protein 1


The function of Bmp7 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for BMP-7 Antibody (NBP1-69126) (0)

There are no publications for BMP-7 Antibody (NBP1-69126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-7 Antibody (NBP1-69126) (0)

There are no reviews for BMP-7 Antibody (NBP1-69126). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-7 Antibody (NBP1-69126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BMP-7 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMP-7 Antibody (NBP1-69126)

Discover related pathways, diseases and genes to BMP-7 Antibody (NBP1-69126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-7 Antibody (NBP1-69126)

Discover more about diseases related to BMP-7 Antibody (NBP1-69126).

Pathways for BMP-7 Antibody (NBP1-69126)

View related products by pathway.

PTMs for BMP-7 Antibody (NBP1-69126)

Learn more about PTMs related to BMP-7 Antibody (NBP1-69126).

Blogs on BMP-7

There are no specific blogs for BMP-7, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol BMP7

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69126 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought