BMP-7 Antibody


Western Blot: BMP-7 Antibody [NBP1-69126] - Human Fetal Intestine, Antibody Dilution: 0.1 ug/ml.
Immunohistochemistry: BMP-7 Antibody [NBP1-69126] - Human kidney (Proteinase K) Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 5000Color/Signal Descriptions: more
Western Blot: BMP-7 Antibody [NBP1-69126] - Titration: 0.2-1 ug/ml, Positive Control: Rat Lung.
Immunohistochemistry-Paraffin: BMP-7 Antibody [NBP1-69126] - Human Kidney tissue, 5 ug/ml.
Immunohistochemistry-Paraffin: BMP-7 Antibody [NBP1-69126] - Human Skin.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

BMP-7 Antibody Summary

Synthetic peptides corresponding to Bmp7 (bone morphogenetic protein 7) The peptide sequence was selected from the N terminal of Bmp7. Peptide sequence MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Bmp7 and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP-7 Antibody

  • BMP7
  • BMP-7
  • bone morphogenetic protein 7
  • Eptotermin alfa
  • OP-1
  • OP-1OP1
  • Osteogenic protein 1


The function of Bmp7 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for BMP-7 Antibody (NBP1-69126) (0)

There are no publications for BMP-7 Antibody (NBP1-69126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-7 Antibody (NBP1-69126) (0)

There are no reviews for BMP-7 Antibody (NBP1-69126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-7 Antibody (NBP1-69126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BMP-7 Products

Bioinformatics Tool for BMP-7 Antibody (NBP1-69126)

Discover related pathways, diseases and genes to BMP-7 Antibody (NBP1-69126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-7 Antibody (NBP1-69126)

Discover more about diseases related to BMP-7 Antibody (NBP1-69126).

Pathways for BMP-7 Antibody (NBP1-69126)

View related products by pathway.

PTMs for BMP-7 Antibody (NBP1-69126)

Learn more about PTMs related to BMP-7 Antibody (NBP1-69126).

Blogs on BMP-7

There are no specific blogs for BMP-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BMP-7 Antibody and receive a gift card or discount.


Gene Symbol BMP7