Home » BIK » BIK Antibodies » BIK Antibody

BIK Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BIK Antibody [NBP2-87074] - Host: Rabbit. Target Name: BIK. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: BIK Antibody [NBP2-87074] - Host: Rabbit. Target Name: BIK. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BIK Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK. Peptide sequence: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
BIK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BIK Antibody

  • Apoptosis inducer NBK
  • BCL2-interacting killer (apoptosis-inducing)
  • bcl-2-interacting killer
  • BIK
  • BIP1
  • BP4
  • NBK
  • NBKapoptosis-inducing NBK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in human breast carcinoma at 1:2000. Formalin-fixed, paraffin-embedded tissue section from invasive ductal carcinoma. An organellar/mitochondrial pattern of Bcl-xL staining is observed in the cytosol of tumor cells.
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-xL at ~30 kDa.
(1 Review)
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(14 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
Western Blot: Bax Antibody (6A7) [NBP1-28566] - rOPN administration elevated the expression of autophagy-related proteins while suppressing apoptosis in rat brain at 24 h after SAH. The effects of rOPN on expression levels of Bax, mean +/- SD is 1.006 +/- 0.321 in Sham group, 37.47 +/- 10.86 in SAH + Vehicle group, 23.83 +/- 8.143 in SAH + rOPN group, F = 33.13, in the left hemisphere of rat brain at 24 h after SAH. Sample size is 18, n = 6 per group. Data were presented as mean +/- SD. *P < .05, ***P < .001 vs Sham group; #P < .05, ##P < .01 vs SAH + Vehicle group Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/cns.13199) licensed under a CC-BY licence.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment. IHC-F image submitted by a verified customer review
(3 Reviews)
(17 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
BAK Antibody
(SU32-07)
NBP2-67460
Flow Cytometry: BAK Antibody (SU32-07) [NBP2-67460] - Analysis of NIH/3T3 cells with Bak antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: BAK Antibody (SU32-07) [NBP2-67460] - Analysis of paraffin-embedded human lung tissue using anti-Bak antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: BAK Antibody (SU32-07) [NBP2-67460] - Analysis of paraffin-embedded mouse lung tissue using anti-Bak antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Bim Antibody - BSA
Free
NBP1-76963
Immunocytochemistry/Immunofluorescence: Bim Antibody [NBP1-76963] - K562 cells with at 20 ug/mL.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in Rat Myeloma Cell line:Loading: 15 ug of rat myeloma YB2/0 cell lysate per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in HeLa Cells. Loading: 15 ug of lysate per lane. Antibodies: Bim NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate. Bim antibody can detect all three human isoforms, including EL, L and S isoforms.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
BID Antibody
[Unconjugated]
AF860
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for BID at approximately 29 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of SVEC4‑10 mouse vascular endothelial cell line and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for BID at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows Jurkat human acute T cell leukemia cell line treated with apoptosis inducer anti-Fas for the indicated times. PVDF membrane was probed with 1 µg/mL Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BID at approximately 20 kDa (as indicated). For additional reference short (5 seconds, left panel) and long (60 seconds, right panel) exposures are shown. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
(4 Reviews)
(20 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
Mcl-1 Antibody
NB100-56146
Western Blot: MCL1 Antibody [NB100-56146] - analysis of Mcl-1 in A) Ramos and B) ThP-1 lysate using Mcl-1 antibody at 1:2000.
Immunohistochemistry-Paraffin: MCL1 Antibody [NB100-56146] - Formalin-fixed paraffin-embedded tissue sections of human diffuse, aggressive Non-Hodgkin's lymphoma (NHL) of B cell lineage stained for Mcl-1 expression using Mcl-1 antibody at 1:2000. A-D, Mcl-1 staining shown as varying magnifications. Hematoxylin-eosin counterstain.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PUMA Antibody -
BSA Free
NBP1-76639
Western Blot: PUMA Antibody [NBP1-76639] - Independent Antibody Validation (IAV) via Protein Expression ProfileLoading: 20 ug of lysates per lane.Antibodies: NBP1-76654 (3 ug/mL), NBP1-76639 (2 ug/mL), beta-actin (1 ug/mL) and GAPDH (0.02 ug/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
Immunohistochemistry: PUMA Antibody [NBP1-76639] - Analysis of PUMA in human breast tissue with PUMA antibody at 2.5 ug/ml.
Western Blot: PUMA Antibody [NBP1-76639] - Identification of target for LPS-induced miR-29b in OCs. BMMs were incubated with M-CSF (30 ng/ml) and RANKL (40 ng/ml) for 40 h, washed thoroughly, and incubated further with LPS (50 ng/ml) in the presence of M-CSF (30 ng/ml) for 48 h. Cells were transfected with 30 nM of miR-29b mimic or con mimic in the presence of M-CSF (30 ng/ml) for 6 h. Total RNA was analyzed by qPCR to quantify the expression of BMF, PUMA, BAK1, BIM, and HRK. Expression levels with con mimic treatment were set at 1. Cell lysates were subjected to Western blot analysis with antibodies against BMF, PUMA, BAK1, BIM, HRK, and BCL-2. Antibodies against beta-actin were used for normalization. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/omcl/2019/6018180/) licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(58 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Noxa Antibody
(114C307.1) - Non-Rec ...
NB600-1159
Immunocytochemistry/Immunofluorescence: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - ICC/IF analysis using the azide-free version of NB600-1159 at 1:10. HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). Image objective 40X.
Immunohistochemistry-Paraffin: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - Bouin-fixed, paraffin-embedded Chronic Lymphocytic Leukemia (CLL) xenograft stained with Noxa antibody (1:2000), peroxidase-conjugate and DAB chromogen. Staining for 2 hr at RT. Image using the azide-free form of this antibody.
Flow Cytometry: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - Flow cytometry after an intracellular stain was performed on HeLa cells with Noxa [114C307.1] antibody NB600-1159AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(2 Reviews)
(73 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Exacerbated apoptosis and altered inflammation in double-deficient Atg7deltapan-Rip3-/- mice. (c) Depletion of Rip3 and pancreatic Atg7 (Atg7deltapan-Rip3d/d) increased pancreatic caspase-9 in 12-week-old mice. Caspase-9 quantitation and representative IF microphotographs of Atg7deltapan (n=5) and Atg7deltapan-Rip3d/d (n=5) pancreatic tissue stained for DAPI (blue) and Caspase-9 (red) (1/1000).. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/cddis.2017.313), licensed under a CC-BY licence.
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Autophagy-deficient mice showed increased activity of apoptosis and necroptosis. Increased the expression of Caspase-9 in 12-week-old Atg7deltapan mice. Caspase-9 quantitation and representative IF microphotographs of Atg7F/F (n=5) and Atg7deltapan (n=5) pancreatic tissue stained for DAPI (blue) and Caspase-9 (green) (1/1000, scale bar=50?um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/cddis.2017.313), licensed under a CC-BY licence.
Immunohistochemistry: Caspase-9 Antibody [NB100-56118] - Mice with two different spontaneous mutant alleles of Sharpin show variations in onset of CPDM phenotype. However, the onset is much more rapid in Sharpincpdm-Dem mice as evidenced by antibody detection of cleaved CASPASE 9 (T) when compared to Sharpincpdm mutants (R) or WT mice (Q,S). . Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0085666) licensed under a CC-BY licence.
(1 Review)
(20 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(12 Reviews)
(191 Publications)
Species: Hu, Mu
Applications: ICC, IHC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
Fas/TNFRSF6/CD95
[HRP]
DFS00
(1 Review)
(17 Publications)
Species: Hu
Applications: ELISA
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for XIAP at approximately 59 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and XIAP knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XIAP at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Bad Antibody
NB100-56080
Western Blot: Bad Antibody [NB100-56080] - Analysis of Bad in Daoy whole cell lysate using anti-Bad antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Bad Antibody [NB100-56080] - Immunofluorescence microscopy of BAD using NB100-56080 at 1:2000. Du145 human prostate carcinoma cells were cultured without (A) or with (B) and (C) 1 uM of the triphosphatase inhibitor thapsigargin (THG) for 12 hr. A and B, staining with BAD antibody, followed by a FITC-conjugated secondary antibody. C, staining with a mitochondrial marker (antibody to mitochondrial Hsp60), followed by a rhodamine-conjugated secondary antibody. THG induces Ca2+ release from internal stores which can promote apoptosis. BAD staining was located diffusely throughout the cytoplasm of untreated cells (A), and localized to the mitochondria in treated cells (B).
Immunohistochemistry-Paraffin: Bad Antibody [NB100-56080] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human liver using 1:2000 conc. of Bad antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining of Bad was observed. Staining was performed by Histowiz.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(2 Reviews)
(49 Publications)
Species: Hu
Applications: BA
Hrk
WBC013
Hrk
Species: Hu
Applications: WB
BIK Antibody
NBP2-87074
BIK Antibody
Species: Hu
Applications: WB

Publications for BIK Antibody (NBP2-87074) (0)

There are no publications for BIK Antibody (NBP2-87074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIK Antibody (NBP2-87074) (0)

There are no reviews for BIK Antibody (NBP2-87074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIK Antibody (NBP2-87074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BIK Products

Array NBP2-87074

Bioinformatics Tool for BIK Antibody (NBP2-87074)

Discover related pathways, diseases and genes to BIK Antibody (NBP2-87074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIK Antibody (NBP2-87074)

Discover more about diseases related to BIK Antibody (NBP2-87074).
 

Pathways for BIK Antibody (NBP2-87074)

View related products by pathway.

PTMs for BIK Antibody (NBP2-87074)

Learn more about PTMs related to BIK Antibody (NBP2-87074).
 

Research Areas for BIK Antibody (NBP2-87074)

Find related products by research area.

Blogs on BIK

There are no specific blogs for BIK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIK Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BIK