BIK Antibody

Images

 
Western Blot: BIK Antibody [NBP2-87074] - Host: Rabbit. Target Name: BIK. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BIK Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK. Peptide sequence: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
BIK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BIK Antibody

  • Apoptosis inducer NBK
  • BCL2-interacting killer (apoptosis-inducing)
  • bcl-2-interacting killer
  • BIK
  • BIP1
  • BP4
  • NBK
  • NBKapoptosis-inducing NBK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-67460
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56146
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-76639
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-1159
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DFS00
Species: Hu
Applications: ELISA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56080
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
375-TL
Species: Hu
Applications: BA
Hrk
WBC013
Species: Hu
Applications: WB
NBP2-87074
Species: Hu
Applications: WB

Publications for BIK Antibody (NBP2-87074) (0)

There are no publications for BIK Antibody (NBP2-87074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIK Antibody (NBP2-87074) (0)

There are no reviews for BIK Antibody (NBP2-87074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIK Antibody (NBP2-87074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BIK Products

Array NBP2-87074

Bioinformatics Tool for BIK Antibody (NBP2-87074)

Discover related pathways, diseases and genes to BIK Antibody (NBP2-87074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIK Antibody (NBP2-87074)

Discover more about diseases related to BIK Antibody (NBP2-87074).
 

Pathways for BIK Antibody (NBP2-87074)

View related products by pathway.

PTMs for BIK Antibody (NBP2-87074)

Learn more about PTMs related to BIK Antibody (NBP2-87074).
 

Research Areas for BIK Antibody (NBP2-87074)

Find related products by research area.

Blogs on BIK

There are no specific blogs for BIK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIK