The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to TGFBI(transforming growth factor, beta-induced, 68kDa) The peptide sequence was selected from the C terminal of TGFBI. Peptide sequence LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGFBI
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
transforming growth factor-beta-induced protein ig-h3
Background
TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Beta Ig-h3/TGFBI Antibody (NBP1-60049) (0)
There are no reviews for Beta Ig-h3/TGFBI Antibody (NBP1-60049).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Beta Ig-h3/TGFBI Antibody - BSA Free and receive a gift card or discount.