Carbonic Anhydrase I/CA1 Antibody

Images

 
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human lymphoid tissues shows no positivity in non-germinal or germinal center cells as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Carbonic Anhydrase I/CA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
Specificity
Specificity of human Carbonic Anhydrase I/CA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
WB reported in scientific Thesis. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-88191 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%). Mouse reactivity reported in the scientific literature Thesis.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase I/CA1 Antibody

  • CA1
  • CA-I
  • Car1
  • Carbonate dehydratase I
  • carbonic anhydrase 1
  • Carbonic anhydrase B
  • Carbonic Anhydrase I
  • carbonic anhydrase ICAB
  • carbonic dehydratase
  • EC 4.2.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB2186
Species: Hu
Applications: WB, IHC, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-88191 Applications Species
Yagensky O. Identifying stage-specific markers of Alzheimer's disease using quantitative proteomics.. Thesis Jul 10 1905 (WB, Mouse) WB Mouse

Reviews for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191) (0)

There are no reviews for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase I/CA1 Products

Bioinformatics Tool for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)

Discover related pathways, diseases and genes to Carbonic Anhydrase I/CA1 Antibody (NBP1-88191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)

Discover more about diseases related to Carbonic Anhydrase I/CA1 Antibody (NBP1-88191).
 

Pathways for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)

View related products by pathway.

PTMs for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)

Learn more about PTMs related to Carbonic Anhydrase I/CA1 Antibody (NBP1-88191).
 

Research Areas for Carbonic Anhydrase I/CA1 Antibody (NBP1-88191)

Find related products by research area.

Blogs on Carbonic Anhydrase I/CA1

There are no specific blogs for Carbonic Anhydrase I/CA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase I/CA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA1