Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - 293T cells lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus Gene name: HSD3B2 Submitted by: Jonathan Bertin, Endoceutics Inc.

Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-59531] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus Gene name: HSD3B2 Submitted by: Jonathan Bertin, Endoceutics Inc.

• Reactivity: Hu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HSD3B2(hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2) The peptide sequence was selected from the N terminal of HSD3B2. Peptide sequence GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD3B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free

• 3 beta-HSD type II
• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II
• 3-beta-HSD II
• delta 5-delta 4-isomerase type II
• HSD3B
• HSDB
• HSDB3B
• hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase
• progesterone reductase
• SDR11E2
• short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase

Background

3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD3B2
• Uniprot:
  • P26439(Human)