![Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Analysis in human liver and skeletal muscle tissues using NBP2-49284 antibody. Corresponding CYB5A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp2-49284_rabbit-polyclonal-cytochrome-b5-type-a-antibody-immunohistochemistry-paraffin-13320259841..png "Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Analysis in human liver and skeletal muscle tissues using NBP2-49284 antibody. Corresponding CYB5A RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Cytochrome b5 type A Antibody - BSA Free (NBP2-49284) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-Cytochrome b5 type A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYB5A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Testes, separated by Size, antibody dilution of 1:20, apparent MW was 20 kDa |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Publication using NBP2-49284 | Applications | Species |
|---|---|---|
| Savchuk I, Morvan M. L, et al. Ontogenesis of human fetal testicular steroidogenesis at early gestational age. Steroids 2019-01-01 [PMID: 30529237] (Simple Western, IHC, Human) | Simple Western, IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome b5 type A Antibody (NBP2-49284)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYB5A |
![Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/fullsize/Cytochrome-b5-type-A-Antibody-Western-Blot-NBP2-49284-img0003.jpg "Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue")
![Immunocytochemistry/Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Cytochrome-b5-type-A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49284-img0004.jpg "Immunocytochemistry/Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/Cytochrome-b5-type-A-Antibody-Immunohistochemistry-Paraffin-NBP2-49284-img0005.jpg "Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/antibody/nbp2-49284_rabbit-polyclonal-cytochrome-b5-type-a-antibody-immunohistochemistry-paraffin-13320259951..png "Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/antibody/nbp2-49284_rabbit-polyclonal-cytochrome-b5-type-a-antibody-immunohistochemistry-paraffin-133202591041..png "Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp2-49284_rabbit-polyclonal-cytochrome-b5-type-a-antibody-immunohistochemistry-paraffin-133202591145..png "Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] -Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")