Cytochrome b5 type A Antibody

Images

 
Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver ...read more
Immunocytochemistry/ Immunofluorescence: Cytochrome b5 type A Antibody [NBP2-49284] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining in human liver and skeletal muscle tissues using anti-CYB5A antibody. Corresponding CYB5A RNA-seq data ...read more
Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Cytochrome b5 type A Antibody [NBP2-49284] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cytochrome b5 type A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytochrome b5 type A Recombinant Protein Antigen (NBP2-49284PEP)
Publications
Read Publication using
NBP2-49284 in the following applications:

  • SW
    1 publication

Reactivity Notes

Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome b5 type A Antibody

  • CYB5
  • cytochrome b5 (microsomal)
  • cytochrome b5 type A (microsomal)
  • cytochrome b-5
  • MCB5cytochrome b5
  • Microsomal cytochrome b5 type A
  • type 1 cyt-b5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
NBP2-50209
Species: Hu
Applications: ELISA, IHC, WB
H00001551-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1107
Species: Mu
Applications: IHC, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for Cytochrome b5 type A Antibody (NBP2-49284)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: SW.


Filter By Application
SW
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Cytochrome b5 type A Antibody (NBP2-49284) (0)

There are no reviews for Cytochrome b5 type A Antibody (NBP2-49284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytochrome b5 type A Antibody (NBP2-49284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome b5 type A Products

Bioinformatics Tool for Cytochrome b5 type A Antibody (NBP2-49284)

Discover related pathways, diseases and genes to Cytochrome b5 type A Antibody (NBP2-49284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome b5 type A Antibody (NBP2-49284)

Discover more about diseases related to Cytochrome b5 type A Antibody (NBP2-49284).
 

Pathways for Cytochrome b5 type A Antibody (NBP2-49284)

View related products by pathway.

Research Areas for Cytochrome b5 type A Antibody (NBP2-49284)

Find related products by research area.

Blogs on Cytochrome b5 type A

There are no specific blogs for Cytochrome b5 type A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome b5 type A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB5A