BCORL1 Antibody

Images

 
Immunohistochemistry-Paraffin: BCORL1 Antibody [NBP1-90607] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCORL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCORL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCORL1 Protein (NBP1-90607PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCORL1 Antibody

  • BCL6 corepressor-like 1
  • BCL-6 corepressor-like protein 1
  • BCoR-L1
  • BCoR-like protein 1
  • CXorf10
  • FLJ11362
  • FLJ11632

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF6947
Species: Hu
Applications: WB
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44092
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1280
Species: Hu, Mu, Po, Bv, Ca
Applications: ChIP, PEP-ELISA

Publications for BCORL1 Antibody (NBP1-90607) (0)

There are no publications for BCORL1 Antibody (NBP1-90607).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCORL1 Antibody (NBP1-90607) (0)

There are no reviews for BCORL1 Antibody (NBP1-90607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCORL1 Antibody (NBP1-90607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCORL1 Products

Bioinformatics Tool for BCORL1 Antibody (NBP1-90607)

Discover related pathways, diseases and genes to BCORL1 Antibody (NBP1-90607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCORL1 Antibody (NBP1-90607)

Discover more about diseases related to BCORL1 Antibody (NBP1-90607).

Blogs on BCORL1

There are no specific blogs for BCORL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCORL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCORL1