MRPL36 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MRPL36 Antibody [NBP1-92139] - Staining of human cell line HeLa shows localization to nuclear bodies & mitochondria.

Immunohistochemistry-Paraffin: MRPL36 Antibody [NBP1-92139] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows moderate granular cytoplasmic positivity in subset of cells in seminiferous ducts.

Staining of human cerebral cortex shows weak granular cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL36 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL36 Antibody - BSA Free (NBP1-92139) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL36
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPL36 Protein (NBP1-92139PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL36 Antibody - BSA Free

• BRCA1-interacting protein 1
• BRIP1MGC104245
• L36mtMRP-L36PRPL36
• mitochondrial ribosomal protein L36,39S ribosomal protein L36, mitochondrial
• putative BRCA1-interacting protein
• RPMJ

Background

MRPL36, also known as 39 S ribosomal protein L36, mitochondrial, is an 11.8 kDa, 103 amino acid protein that is utilized in the large ribosomal subunit in the mitochondria. Diseases and disorders such as Wolf-Hirschhorn syndrome and genital herpes are being researched with this protein. The protein interacts with RRAS, UPF1, MRPL3, BRCA1, and RPS16 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL36