Bcl-6 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining in human tonsil and pancreas tissues. Corresponding BCL6 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human lymphoma, non-Hodgkin's type, shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Bcl-6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acid sequence: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
Specificity
Specificity of human Bcl-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Bcl-6 Recombinant Protein Antigen (NBP2-59786PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Bcl-6 Antibody

  • B-cell CLL/lymphoma 6
  • B-cell lymphoma 6 protein transcript
  • Bcl-5
  • BCL5B-cell lymphoma 5 protein
  • Bcl6
  • Bcl-6
  • BCL6A
  • cys-his2 zinc finger transcription factor
  • LAZ3
  • LAZ3ZBTB27B-cell lymphoma 6 protein
  • lymphoma-associated zinc finger gene on chromosome 3
  • Protein LAZ-3
  • ZBTB27
  • Zinc finger and BTB domain-containing protein 27
  • Zinc finger protein 51ZNF51
  • zinc finger transcription factor BCL6S
  • ZNF51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
NBP1-47396
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP2-67309
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1636
Species: Hu
Applications: WB, Simple Western, Flow, AgAct, CyTOF-ready, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00002629-M01
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-59786
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Bcl-6 Antibody (NBP2-59786) (0)

There are no publications for Bcl-6 Antibody (NBP2-59786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl-6 Antibody (NBP2-59786) (0)

There are no reviews for Bcl-6 Antibody (NBP2-59786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Bcl-6 Antibody (NBP2-59786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Bcl-6 Products

Bioinformatics Tool for Bcl-6 Antibody (NBP2-59786)

Discover related pathways, diseases and genes to Bcl-6 Antibody (NBP2-59786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl-6 Antibody (NBP2-59786)

Discover more about diseases related to Bcl-6 Antibody (NBP2-59786).
 

Pathways for Bcl-6 Antibody (NBP2-59786)

View related products by pathway.

PTMs for Bcl-6 Antibody (NBP2-59786)

Learn more about PTMs related to Bcl-6 Antibody (NBP2-59786).
 

Research Areas for Bcl-6 Antibody (NBP2-59786)

Find related products by research area.

Blogs on Bcl-6

There are no specific blogs for Bcl-6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bcl-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL6